(data stored in ACNUC7421 zone)

EMBL: CP001402.PE647

CP001402.PE647       Location/Qualifiers
FT   CDS_pept        606456..608195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0665"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41283"
FT                   /db_xref="GOA:C4KF67"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF67"
FT                   /protein_id="ACR41283.1"
FT                   /translation="MKLILLSILLGLIILLFIPVFNGGSQFYVLEVSSIFPFEINGVSY
FT                   PPGNYYLMYRGIVNITFFNLYYQSNTSRLHLIGINFNGTFLNSSSEIIGILKIYSKNNF
FT                   TSVIVNTTELFYTHISSLYDKEFYVIVNARHGSPISSGWYASGELLTIPLGDTYQNGSI
FT                   RYIISHVLVNGTQKTSFNVNSPLIVNVTYLVEYLVNFSKPTYAYMNGSLEIMSSQWLPN
FT                   NTQLAIPKYINLTRDTRIFTTGNLTGVVYINKPIIINDTQIFQYYVNVKDPAIAKINGN
FT                   YTNFTSNWYNAGTQIFIPPYFPLINDYRIAIYGNLTGMFTIESPLIINDRENIQYYLQF
FT                   PFPLQISLSNGTLYYGTNIWINNGTYAIIYSQIRYINNVTRAIVIQQVFNSPNFGKLNY
FT                   ILQYFVTSNLPLPVSINGTNTTLTNGWFNQSTEFYVYPVYYVNSTERIVILYINYRNIT
FT                   LLSPLSFNVYYIKEYLVNIEGYYSHSVILDEKLWEPYGSIVQIPLQYEYEGIYFESNST
FT                   TNQYYIFGPSNITIYYKPIDITTSVYTPVIAGLPIEAFVITIIIIIVLALVLLIFNRSR
FT                   VNK"
     atgaaattga tactgctgag catattactt gggctaatta tactgttgtt tattccggtt        60
     tttaatggag gcagccaatt ttacgtgctt gaagtgtcaa gtatatttcc atttgagata       120
     aacggtgtat cttatccccc tggcaattac tatctaatgt atagaggaat agtaaatata       180
     acctttttca atttatatta tcaatcaaat acatcaagat tacatcttat aggaataaac       240
     tttaatggca ctttccttaa ttcttcatca gaaattatag gcatattaaa aatttatagt       300
     aaaaataatt tcacatctgt aatagttaac actactgagc tattttatac ccatatttct       360
     tctctttatg acaaagaatt ttatgttata gttaatgcta ggcatggttc tccaataagt       420
     agcggttggt atgcttctgg tgagttactt acaatacctt taggtgatac ctatcaaaat       480
     ggttcaataa ggtacataat atctcatgta ttggttaacg gcacacagaa aacctctttt       540
     aatgttaatt cgcctttgat agtcaatgtt acatatcttg tagaatattt ggttaacttt       600
     tctaaaccta cgtatgccta tatgaatggc agtttagaaa taatgagctc ccaatggtta       660
     cctaataata ctcaactagc tattccaaaa tatattaatc taactagaga taccagaata       720
     tttactactg gaaatcttac tggcgtagta tatatcaata agccgataat tataaatgat       780
     actcaaattt ttcaatatta tgttaacgtt aaggacccag caatagctaa aattaatgga       840
     aactatacta attttacttc aaattggtac aacgcaggaa cacagatatt tatcccccca       900
     tattttcctt taattaatga ttatagaata gccatatatg gaaatcttac tgggatgttt       960
     actatagagt ctccacttat aataaatgat agagaaaaca tccaatacta tttgcaattt      1020
     ccattccctt tacaaataag tctatctaat ggtacattat actatggaac aaatatatgg      1080
     attaataatg gtacttatgc gataatatat tctcaaatac gttatataaa taacgtaact      1140
     agagcaatag taatacaaca agtctttaat tctccaaatt ttgggaaatt aaattatatc      1200
     ttacaatatt ttgttacttc aaatctaccg ttacccgttt ccataaatgg aactaacact      1260
     acattaacta atggctggtt taaccaaagt acagaatttt acgtctatcc tgtctattat      1320
     gtgaactcta ccgagagaat agtaatctta tacattaatt atagaaatat tactctactc      1380
     tcgccactat cttttaacgt atattatatt aaagaatatt tagttaacat agagggatat      1440
     tattcacatt cagttatatt agacgagaaa ctctgggaac cttacggttc tattgtgcaa      1500
     ataccattgc aatatgaata tgaaggtatc tattttgaat ccaattcaac tactaatcaa      1560
     tattatatat ttggtccttc aaacattacg atttattata agccgataga tattacaact      1620
     tcagtctata ctccagtaat tgcaggatta cctatagaag cattcgtaat aactataatt      1680
     ataataatcg tcttagcgtt agttttactt atatttaaca gaagtagagt taataaataa      1740
//

If you have problems or comments...

PBIL Back to PBIL home page