(data stored in ACNUC7421 zone)

EMBL: CP001402.PE65

CP001402.PE65        Location/Qualifiers
FT   CDS_pept        complement(56666..58168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0065"
FT                   /product="protein of unknown function DUF87"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40701"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR008571"
FT                   /db_xref="InterPro:IPR018538"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033186"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJI1"
FT                   /protein_id="ACR40701.1"
FT                   /translation="MIIGYVIGQATTQEALILAERPVRLGTYVVLEYDNVKALGLITNV
FT                   TRGSPMLDDNMNDIEIVQRLKQFNNSIPVYTKAKVKMLCDMNNHFLMPDIPPFAGTPAR
FT                   EAEDEELKSIYSQDGQIRIGSLIGKNVEVKLNINSFARHLAILAATGSGKSNTVAVLSQ
FT                   RISELGGSVLIFDYHGEYYDSDIKNLNRIEPKLNPLYMTPREFSTLLEIRENAVIQYRI
FT                   LRRAFIKVTNEIREKLKEGQIPFSTLNSQFYELMRDELETQGNSDKKSSAKDEVLNKFE
FT                   EFMDRYSNVIDLTSSDIIEKVKRGKVNVVSLTQLDEDSMDAVVSHYLRRILDSRKDFKR
FT                   SKNSGLKFPIIAVIEEAHVFLSKNENTLTKYWASRIAREGRKFGVGLTIVSQRPKGLDE
FT                   NILSQMTNKIILKIIEPTDKKYILESSDNLSEDLAEQLSSLDVGEAIIIGKIVKLPAVV
FT                   KIDMFEGKLLGSDPDMIGEWKRAEENERIAKGFADFGTEIGD"
     atgataattg gttatgtaat tggtcaagct acaacacaag aggctttgat actagctgaa        60
     aggccagtta gattaggaac ttatgttgtt ctagaatatg ataacgttaa ggcccttgga       120
     ctaataacaa acgtgactag aggtagccct atgctagatg ataatatgaa tgatatagaa       180
     atcgttcaaa gattaaaaca attcaacaat agcatacccg tttatacaaa ggctaaagta       240
     aaaatgttat gtgatatgaa taatcacttt ttaatgcccg atataccccc gttcgctgga       300
     accccagcta gagaggctga agatgaggag ttaaaaagta tttattcgca agatggccaa       360
     attagaatag gaagcttaat aggtaaaaac gtggaggtta aattaaatat aaattccttt       420
     gcaagacatt tagctatttt agcagctact ggttctggga agtcaaatac agtagcagtt       480
     ctttctcaaa gaatttctga acttggtgga tctgttctta tctttgatta tcatggagag       540
     tactatgata gcgatataaa gaatctaaat cgtattgaac ctaaacttaa ccctctttat       600
     atgaccccaa gggaattttc tacgttacta gaaataagag agaatgcagt tatacagtac       660
     agaattttaa gaagagcttt cataaaggta acaaatgaga taagagaaaa gctaaaagaa       720
     ggacaaatac cattttctac tctaaatagc caattttatg aactaatgag agacgaattg       780
     gaaactcaag gaaatagtga taaaaagagt agtgcaaagg atgaggtact gaataagttt       840
     gaagaattca tggataggta ttcaaacgtc attgatctta catcttcaga tataattgaa       900
     aaagtaaaga gaggtaaggt aaacgttgta agcctaacac aattagatga agactcaatg       960
     gatgcagtag tctcacatta tttaagaaga atccttgatt ctaggaaaga ttttaaaaga      1020
     agcaaaaata gtggccttaa attcccaata atagccgtaa tagaagaagc tcacgttttc      1080
     ttgtctaaaa acgagaatac attaaccaag tactgggcgt ccaggatagc aagagagggc      1140
     agaaaattcg gagttggatt aacaatagta agtcaaaggc ctaaaggcct agatgaaaat      1200
     atattaagtc aaatgacaaa caagatcatt ttaaagataa ttgaacctac tgataaaaaa      1260
     tacatcttag agtcaagtga taatctaagc gaagatttag ctgaacaact gtcctccttg      1320
     gacgttggtg aggctataat tataggtaaa atagtaaaat tacctgcagt tgtgaagata      1380
     gatatgtttg aaggaaaatt gcttggatca gaccccgaca tgatagggga atggaagaga      1440
     gcagaagaaa atgaaagaat agctaaaggc tttgccgact ttggaacgga aattggtgat      1500
     tga                                                                    1503
//

If you have problems or comments...

PBIL Back to PBIL home page