(data stored in ACNUC7421 zone)

EMBL: CP001402.PE652

CP001402.PE652       Location/Qualifiers
FT   CDS_pept        complement(612620..612916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0670"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41288"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038723"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF72"
FT                   /protein_id="ACR41288.1"
FT                   /translation="MIENRRRTKTEIIYSILRGCSEGSKKTRLMYLAKLNYSVFMKYIY
FT                   KMKQMNLIEFNEGKCVLTDKGKRVLELLDKYMEMYSELNEVRRKLEELMQTES"
     atgattgaga atagaagaag gactaagact gaaataattt acagcatttt aagaggttgt        60
     agcgaaggaa gtaagaagac tagattaatg tatcttgcta agttgaacta ttcagttttt       120
     atgaaatata tttataagat gaaacaaatg aatttaatag aatttaatga aggaaaatgt       180
     gttttgacag ataagggaaa aagagtacta gaattgttgg ataaatacat ggagatgtat       240
     agcgagctta atgaagttag aaggaaattg gaagagctaa tgcagactga atcttaa          297
//

If you have problems or comments...

PBIL Back to PBIL home page