(data stored in ACNUC7421 zone)

EMBL: CP001402.PE655

CP001402.PE655       Location/Qualifiers
FT   CDS_pept        complement(616560..617621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0673"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41291"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF75"
FT                   /protein_id="ACR41291.1"
FT                   /translation="MCTTHLELDELYYSNDPRNVLRFYEMFDSAEELIDWMKRRPKADV
FT                   NIYEVEGDTDIVIVIPTANVNSDYAKMDLNIYKGFQMIFCESSGRYFNYAHSINICVKE
FT                   AMKYNPEWVIFSNDDVYKIDEPYILRNELKKLDYKNVSTILPSDRNYQFHYNELRILKP
FT                   TFIKGYRSFFLGSLSLLYDEIFRKSTKNIDISLILLLARAQIYYNKLLRRFNLPYVDLR
FT                   VIDKKLICKIRHIIENLFNEYINTFIIKKFGDFGGFSRTFLNKNNSVIFDETFINGVEN
FT                   YDLSFKLMIEKVPVKVIRYRKGSYKGRSLGVGINNMGISRNFRNFANYIYFACKHYNEL
FT                   LYNNSIKCSYQHV"
     atgtgtacta ctcatttaga actcgacgag ttatattact caaatgatcc taggaacgta        60
     ttacgctttt acgaaatgtt tgattcagca gaagagttaa tagactggat gaaaagaaga       120
     cccaaggctg atgttaatat ctatgaagtg gaaggtgata ctgatatagt aattgtaatt       180
     cctaccgcaa atgttaatag tgattatgct aaaatggatt tgaacatata taaaggattt       240
     caaatgattt tctgtgagag ttctggaagg tattttaatt atgctcatag cattaatata       300
     tgtgttaagg aagcaatgaa atataatcca gaatgggtta tcttttcgaa tgatgatgta       360
     tacaagattg atgaacctta tattttgcga aatgaactaa aaaaactaga ttataagaac       420
     gtatctacaa ttcttccttc cgatagaaat tatcagtttc attataatga acttagaatt       480
     ttgaaaccaa catttataaa aggttatagg agttttttcc tcggttcttt atcattgcta       540
     tatgacgaga tatttagaaa gtcaactaag aatattgata tatctttgat attactttta       600
     gctagggctc aaatttacta taataaattg ctaagaagat ttaacttgcc ttacgttgat       660
     ttaagagtaa ttgataagaa attaatatgc aaaataagac atataattga aaatttattc       720
     aatgaataca taaatacgtt tattattaaa aaatttggtg attttggagg atttagcaga       780
     acttttttga acaagaataa tagcgtaatt tttgatgaaa cttttataaa tggggttgaa       840
     aattatgatc tctcttttaa acttatgata gaaaaggtgc cggtaaaagt aataagatat       900
     agaaaaggct cctataaggg cagaagtctt ggagtaggta taaataatat gggaatatct       960
     agaaatttca gaaattttgc taattatata tattttgcat gtaagcatta taacgaatta      1020
     ttatataata atagtataaa atgtagttat caacatgtgt ag                         1062
//

If you have problems or comments...

PBIL Back to PBIL home page