(data stored in ACNUC7421 zone)

EMBL: CP001402.PE656

CP001402.PE656       Location/Qualifiers
FT   CDS_pept        617893..619017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0674"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41292"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF76"
FT                   /protein_id="ACR41292.1"
FT                   /translation="MVKLKRRDFIGLTIAGGTIAGLVNFLENKPKSNLVQITNKKAFLY
FT                   EYFAIVYGNPEIGYKAIDNNGQILFDGKCSDGTGTCGIYEALEYVESNYGYGKIIIFGN
FT                   FYPVNSPPSISSDVEIEGNATIYVNPNSLPFVLSLRLRKIRVLWYKNIGIINNMLAKRN
FT                   IFSLNPYVLFTNTYESLLLSNGEQTIGEPSSFTISAWVYGEQNPYGGYILSYGSLERGI
FT                   VWTLQSTQNSIIFSGSSGKVSSIAPQSTPFHIGITWNNGYTELYINGKMVNSAEIQIEY
FT                   KSPAYIWINNFPIQSQQSGLNLPSWFSYVENIQLYNSVLSESQILQLASSPIQDPVDQS
FT                   IILWALYRYVMYLGDLITGKGFQRIGALFYNGPM"
     atggtaaagc ttaaaagaag ggattttata ggcttaacta tagcaggagg cacaattgct        60
     ggattagtaa acttcttaga aaacaaacct aaaagtaatc tagtgcaaat aactaataag       120
     aaagcttttt tatatgagta ttttgccata gtctacggca atcctgagat aggttacaaa       180
     gcaattgaca ataacggaca aatattattt gatggaaaat gtagtgatgg aacaggaact       240
     tgcggtatat atgaagcatt agagtacgta gaatcgaatt atggatatgg aaaaataatt       300
     atttttggta atttctatcc agtcaattca ccaccttcta tttcaagtga tgtagaaatt       360
     gaaggaaacg caactatcta cgttaatccc aatagtctcc catttgtatt atccttacga       420
     ctaagaaaga taagagtatt atggtataaa aatataggca taataaacaa tatgttagct       480
     aaaagaaaca tattttctct gaacccctat gtactcttta caaatacata tgaaagtctc       540
     ctattaagta atggagaaca aactattggt gagcctagtt catttactat ctcagcatgg       600
     gtatatggag aacaaaaccc ttatggagga tatatcttgt cgtacggctc tctcgaaaga       660
     ggaatagtat ggactctgca aagcactcaa aactctataa tttttagcgg aagttcaggg       720
     aaagtttcca gcattgctcc tcaatctacg ccttttcaca taggtataac atggaataac       780
     ggatatacag agttatatat taatggaaaa atggttaact cagctgaaat tcaaatagaa       840
     tataaaagtc ctgcttacat atggattaat aattttccaa ttcagtcaca acaaagtgga       900
     cttaatttac cttcctggtt ttcatatgta gagaatatac aattatataa ttcagtatta       960
     tcagagtcac aaatattaca attagcttca tcgccaatcc aagatccagt agatcaatca      1020
     attattttat gggcccttta tagatatgta atgtatttag gtgatcttat aaccggtaaa      1080
     ggttttcaga gaataggtgc cctattttat aatggtccta tgtag                      1125
//

If you have problems or comments...

PBIL Back to PBIL home page