(data stored in ACNUC7421 zone)

EMBL: CP001402.PE657

CP001402.PE657       Location/Qualifiers
FT   CDS_pept        619538..620296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0675"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41293"
FT                   /db_xref="GOA:C4KF77"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF77"
FT                   /protein_id="ACR41293.1"
FT                   /translation="MYTRFKNIRNLRNISESVNTKLIAAISIATALATLLVYQAFVVGF
FT                   VVSNQTTGSVVRINAENALLQIDPIEFTTVSGNGGLSITLPPIAPGTADYAAEIDPGAS
FT                   TPPAMYSAAYLFAIAEVQFNYPGNSNAQAALFASLEDVQANNLPITILVLANPSNNLIQ
FT                   KLTNFPNNEIQIQVVGPGKVNINGQQFWVLATYGLPSNIASQIGTTSVTIGSEGAGANI
FT                   YFLILLGSSGTLPPRGVTFSAALNLYGYQS"
     atgtacacta gatttaaaaa tattagaaac ttacgtaata ttagtgagag cgtgaataca        60
     aaactcatag ctgcaatctc aatagctact gcactagcga ctctattagt ctatcaagca       120
     tttgtagtag gtttcgtagt aagcaatcaa actactggat cagtagttcg aataaacgct       180
     gaaaatgcct tattacagat agatccaata gaatttacta cagtctctgg caatggaggc       240
     cttagtataa cattacctcc gatagcacca ggtactgcag attatgctgc agaaatagat       300
     ccaggtgctt ctactccgcc agcgatgtat tcagcagcct atttgtttgc aatagctgaa       360
     gtacaattca attatcctgg taatagcaat gcacaagcag cacttttcgc aagcttagaa       420
     gatgttcaag caaacaactt gccaataaca atcctagtat tagcaaatcc aagcaataac       480
     ctaatacaaa aattaacaaa cttccctaat aacgaaatcc aaattcaagt agttggtcct       540
     ggtaaggtta atattaatgg ccaacaattt tgggtattag caacttatgg tttaccaagt       600
     aatattgcaa gccagatagg aactacatca gttactatag gatctgaggg tgctggtgca       660
     aacatttact tcttaatatt gctaggaagt tctggcacat taccacctag aggcgtaaca       720
     tttagcgcag ctctaaacct atatggctat caaagctag                              759
//

If you have problems or comments...

PBIL Back to PBIL home page