(data stored in ACNUC7421 zone)

EMBL: CP001402.PE658

CP001402.PE658       Location/Qualifiers
FT   CDS_pept        620346..621413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0676"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41294"
FT                   /db_xref="GOA:C4KF78"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF78"
FT                   /protein_id="ACR41294.1"
FT                   /translation="MSSYFLYYTSVKCFKTLINVLLILLIVFSIIITSSNLFGRPTFLA
FT                   ITYGYSMFPVLKPGDVIITIPEPLAGPITNGSIIVFKDPDYGKIPGYPPYIIHQVISIL
FT                   PNGTFITKGINDNFIDQIYMSPITPSDVYGKAILMNGRPLIFPYLGQIIVFLRSNIIFT
FT                   VILFSILIFVNTGISKKGKTIKFSKVAFTISLGVIIFSLLLILSTFFTTYTTIVYSVSN
FT                   RQGILVGGVNQPSAVNLGVILYNQSKQYSYTVSDRLLFPVVVAINVLGEGNYTINNNYF
FT                   ILYPKESHNVTIIILGNGYKGLHQLVVKTYVIVTLLPFSINMNDPLLSLLIYTSINTLA
FT                   LLSFIIIIVMNGDKV"
     atgtcttcat actttttata ttatacttca gttaaatgtt ttaaaacatt aataaatgta        60
     ttattgatat tattaattgt tttctctata ataataactt cctcgaattt atttggaaga       120
     cccacatttc tagcaatcac ctatggatat agtatgttcc ccgttcttaa accgggagat       180
     gtaataataa ctattccaga acctctagct gggcctataa ctaacggaag cattattgta       240
     tttaaggatc cagactatgg taaaatacct gggtatccgc cttatatcat ccatcaagtt       300
     atcagtatat tacctaatgg tacgtttatt acaaaaggca ttaacgataa ttttattgat       360
     cagatataca tgtcccctat aacgccttct gatgtgtatg ggaaggcaat tctaatgaac       420
     ggaagacccc ttatatttcc ttatttaggt caaattattg ttttcttgag atctaatatt       480
     atttttactg taatattatt ttctatattg atttttgtaa atactggtat ctcgaaaaaa       540
     ggaaagacca ttaagttctc gaaagtggca tttacaatta gtctaggagt catcattttc       600
     tccttattgc taatactttc cacgtttttt actacttaca ctacaatagt ttattcagta       660
     tctaatcggc aaggaatttt agtaggagga gttaatcaac catctgcagt aaacttaggt       720
     gtgattttgt ataaccaatc taagcagtac tcctacacag tttcagatag gcttttattt       780
     ccagtagttg ttgcgataaa cgtactaggc gaaggaaatt ataccataaa taataactat       840
     tttatacttt atcctaagga atcacacaat gttacaatta taatattggg aaacggttac       900
     aagggtttac atcaattagt tgtcaagact tatgtaatag taactttact tcctttttct       960
     ataaatatga atgatccttt attatcatta ctaatatata cttctatcaa cacattagct      1020
     ttattatctt ttattattat tatagttatg aatggtgaca aagtatga                   1068
//

If you have problems or comments...

PBIL Back to PBIL home page