(data stored in ACNUC7421 zone)

EMBL: CP001402.PE659

CP001402.PE659       Location/Qualifiers
FT   CDS_pept        621410..621814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0677"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41295"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF79"
FT                   /protein_id="ACR41295.1"
FT                   /translation="MRMLLYVSIIALLLTIISLSMFTPAFDLSFYTSDIYITSNIINIQ
FT                   KQITSNITLVKINIQLSYLNDYVKCVYIIVYGSSNYYNLTGNYAVTANELIEEGNQPFF
FT                   QFSVSNLNNLKIFIVILYNGGGEGILSYYI"
     atgagaatgt tattatatgt ttctattatc gctctacttc ttactattat atccttaagt        60
     atgtttactc cagccttcga tctttcgttt tatacctcgg atatatatat aacgagtaat       120
     atcattaata ttcaaaaaca gatcaccagt aatataactc ttgtaaaaat aaatattcaa       180
     ctcagttacc ttaatgatta tgttaaatgt gtttatataa ttgtgtatgg aagtagtaat       240
     tattataatt taactggaaa ttatgcggta acagctaatg aacttataga ggaagggaat       300
     cagccttttt tccagtttag tgtaagtaat ttaaataatt tgaaaatatt catagttatt       360
     ctctataatg gagggggtga gggaatatta agctattata tataa                       405
//

If you have problems or comments...

PBIL Back to PBIL home page