(data stored in ACNUC7421 zone)

EMBL: CP001402.PE66

CP001402.PE66        Location/Qualifiers
FT   CDS_pept        complement(58264..58812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0066"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40702"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJI2"
FT                   /protein_id="ACR40702.1"
FT                   /translation="MALGKETEMGLKELFKANAEDFMSLMLVAEKLEQLGKKEEAKALR
FT                   EKALVELGHAKAIFETLLKNQELRGVVGEMAKEEQEQHISEYNKVAMTAKQEGHEDIEK
FT                   MLCSFADQEAKIAETIAKVSKVLNEMAKEEQEQHISEYNKVAMTAKQEGHEDIEKMLCT
FT                   FAEQEAKISETIKSVAKAL"
     atggctctcg gaaaagaaac cgaaatgggt ctaaaggagt tatttaaagc aaatgcagaa        60
     gattttatgt cattaatgct agtagctgag aaattagagc aattaggaaa gaaagaagaa       120
     gctaaggcat taagagagaa ggcattagta gaattagggc atgctaaggc aatcttcgag       180
     accttattaa agaaccaaga attaagagga gtagtagggg aaatggctaa agaagagcaa       240
     gaacaacata taagtgagta taataaggtt gcaatgacag caaaacaaga aggacacgaa       300
     gacattgaaa aaatgctatg cagttttgcg gatcaagagg ctaagattgc agaaacgata       360
     gcaaaggttt ctaaagtctt aaatgaaatg gctaaagaag agcaagaaca acatataagt       420
     gagtataata aggttgcaat gacagcaaaa caagaaggac acgaagacat tgaaaaaatg       480
     ctatgcacat tcgccgaaca agaagcaaaa atctcagaaa caatcaaatc tgtcgccaaa       540
     gccttataa                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page