(data stored in ACNUC7421 zone)

EMBL: CP001402.PE660

CP001402.PE660       Location/Qualifiers
FT   CDS_pept        621820..622707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0678"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0678"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41296"
FT                   /db_xref="GOA:C4KF80"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF80"
FT                   /protein_id="ACR41296.1"
FT                   /translation="MIAIILIGSAIFLIYSGIKSNHEITLSKSVPISSYYTNIYYITLF
FT                   NINKTILFDNRTTIIANSMFYILTKNFTVTAIINSTANSINGTYTVNESIKTDYWSKSL
FT                   GSSEGVLKKEMTIFIPNFNYYEKLINITDKQLQIQTGGYTIILNISFNGIMSYPYGNIP
FT                   VNANNSILIYIGYPNITVNVVNDPKISGNFYKQVYVNLESGYNYAYFYFGGFLLLLGIA
FT                   AVFIRLPSIYDVIRRQSVRGPSPPSSNMLIEINNLEDFLRVVKQYGKVPIAFDNGFYII
FT                   DNDVVYVYYNKKSN"
     ttgatagcta taatattaat aggctccgca atatttctga tatactctgg aataaagtcc        60
     aaccatgaaa ttactttatc gaagtcagtt cctatttcct catattatac taatatttat       120
     tatattacgc tatttaatat aaataaaacg atactatttg ataataggac tacaataatt       180
     gcgaattcaa tgttttatat tttaactaaa aatttcacag taactgctat aataaatagc       240
     actgcaaatt ccattaatgg aacttatact gttaacgaga gtattaaaac tgattattgg       300
     tcaaagagct taggaagttc agagggagta ttaaagaaag aaatgactat atttatacct       360
     aattttaatt attatgaaaa attgataaat attactgata aacaattgca aattcaaacg       420
     gggggttata ctataatatt aaatattagt tttaatggta tcatgagtta tccttatggt       480
     aacatacctg ttaatgctaa taattcaatt ctaatatata taggatatcc taacataact       540
     gttaatgtag ttaatgatcc taagatatcg ggtaatttct ataaacaagt atatgttaat       600
     cttgaaagtg gatataatta cgcctatttc tattttggtg gatttctttt acttctaggt       660
     attgctgcag tttttatcag attacctagt atttacgatg ttataaggag acaatcagta       720
     agaggacctt caccaccatc ttcaaacatg ttaatagaga taaacaattt ggaagatttc       780
     ctcagagtag ttaagcaata tggtaaagtt ccaatagcgt ttgacaacgg attttatata       840
     attgataatg acgttgttta tgtgtattat aataaaaaat ctaattaa                    888
//

If you have problems or comments...

PBIL Back to PBIL home page