(data stored in ACNUC7421 zone)

EMBL: CP001402.PE661

CP001402.PE661       Location/Qualifiers
FT   CDS_pept        623578..623880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0679"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0679"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41297"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038723"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF81"
FT                   /protein_id="ACR41297.1"
FT                   /translation="MSRKRNRMEIIANILEECKGGIKKTRLMYKTNLSYRLFCKYTRLL
FT                   EKKGLITFVDNEYRLTAKGYDYLNRVKEYINLMKKLKEMRESLDDLKDEKQLIKR"
     atgagtcgaa agagaaatag aatggagata atagccaata ttttagaaga atgtaaagga        60
     ggaattaaga agactagatt aatgtataaa actaacttaa gctatagact attctgcaaa       120
     tatactagat tactagaaaa aaagggttta ataacttttg ttgataatga atataggctg       180
     accgctaagg gatatgatta cctaaataga gtaaaagaat atattaatct catgaaaaag       240
     cttaaggaga tgagggaatc tttagatgat ttaaaggatg aaaaacaatt aattaaaaga       300
     tga                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page