(data stored in ACNUC7421 zone)

EMBL: CP001402.PE662

CP001402.PE662       Location/Qualifiers
FT   CDS_pept        623905..624528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41298"
FT                   /db_xref="GOA:C4KF82"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF82"
FT                   /protein_id="ACR41298.1"
FT                   /translation="MLNILALTTFLLAIIFGILTEIAMRKYTKQIDRKQKEISMKKTLD
FT                   FLIFLTELVSDSNVTDLLQEIMIYITSMKGKDWDQIYNATMKKLKPIQDQLNQILNQIE
FT                   ELMNIQRIARKIRFYNRLFRELLILLILTIAILIPFSIIKSLLNFYFYAVLLAIGEFII
FT                   TLIIFLLLIINYNKLNINIIKENSKKNTTMVYRNNSNNISYFMN"
     ttgttaaata tattagctct gactactttt ttgcttgcaa ttatttttgg aatattaaca        60
     gagatagcta tgagaaaata tacaaaacag atagacagaa aacaaaagga aatcagcatg       120
     aaaaagactt tagatttttt gattttctta acagagttag taagtgatag taacgttact       180
     gatttactcc aagaaataat gatatatatt acaagtatga agggaaaaga ttgggatcaa       240
     atatataatg ctacaatgaa aaaactaaaa ccaattcaag atcaattgaa tcaaatttta       300
     aatcaaattg aagaactaat gaatatacaa agaatagcaa gaaagataag attttacaat       360
     agattattca gagaattgct tatcttatta atcttaacta ttgctatttt aatacccttt       420
     tcaataatta agagcttact aaacttctat ttctatgcag tattattagc tattggtgag       480
     ttcataatta cattaataat atttctgtta ttaataatta actataataa attaaatata       540
     aatataatta aggaaaattc taagaaaaac actacaatgg tatacagaaa caacagtaat       600
     aatatatcat attttatgaa ctaa                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page