(data stored in ACNUC7421 zone)

EMBL: CP001402.PE663

CP001402.PE663       Location/Qualifiers
FT   CDS_pept        complement(625122..625799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0681"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0681"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41299"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF83"
FT                   /protein_id="ACR41299.1"
FT                   /translation="MVNLYDCALTIEELKMRGYLDISELKEKNLKNIHKFIQFLTRNEI
FT                   VKRRRNRLLLLGDFPKYFVYNISILTNITSDHEEAQSEILINIIPTTTKLYLVEVKEIL
FT                   ARVIGYEKIRIKESIINYSKYTKNFSLDHNLPSWNIISVKSKYFHLIESDNNWKFIKYN
FT                   LYLNMFNFSLNVKFHFNPKDYGIFYSINGEDTRIKCPFNGNNTLKLNLSFPFSTGHYSV
FT                   KWK"
     atggtaaacc tctatgattg tgcactaaca attgaagaat taaaaatgag aggctattta        60
     gatatttctg aacttaaaga aaaaaatctt aagaatatac ataaatttat tcaattcttg       120
     acgaggaatg agatagttaa aagaagaaga aatcgtttgt tacttctagg tgattttcct       180
     aagtactttg tatacaacat ttcaatacta accaatatta ccagtgatca tgaagaggct       240
     caatctgaaa tcttaataaa tataataccc acaacaacta aattatatct agtagaagtg       300
     aaggagatct tagcaagagt aataggatat gagaaaataa gaattaagga atctattata       360
     aactattcta agtatactaa aaattttagc ttagatcata atttaccatc gtggaatata       420
     atatcggtta agagtaaata ttttcatttg attgaatcag ataataattg gaaatttata       480
     aaatataatc tatatctgaa tatgttcaat tttagtctta atgttaaatt tcattttaat       540
     cccaaagact atggaatatt ttattcaata aatggggaag atacgagaat aaaatgtcca       600
     tttaatggca ataatacact taagttaaat ctatcctttc cgtttagcac tggacattac       660
     tctgttaaat ggaaataa                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page