(data stored in ACNUC7421 zone)

EMBL: CP001402.PE664

CP001402.PE664       Location/Qualifiers
FT   CDS_pept        complement(626281..627042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0682"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41300"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF84"
FT                   /protein_id="ACR41300.1"
FT                   /translation="MSYVKVEPNLMKVVEVINKLIYRNGSLCVTFSHIRRETMFHPQTL
FT                   TNLLEKGKTIGLIAECKDLGLGENGYTILQNTVVSLEYSVINEIIKITDNHIIMKHLIK
FT                   NRLYNNSILPLKGIIVKIFGDVLLDMPFIFKGRNNYEIDLTKNILDKYYIFYLDSDIEI
FT                   KPGETYNYEYEFYLKYFPPMDYFITESVNYVMTYSAKTYLTKNEKRVIKSVRLEYPLDV
FT                   KIIEEKQGKTFHEVKIIKLPSCRSIKFWFHI"
     atgagctacg taaaggttga gccaaatctg atgaaagtag ttgaggtaat taataaatta        60
     atttatcgta atggttcgtt atgtgtcacc ttttcccata taagaaggga gacaatgttt       120
     catcctcaaa ctcttacaaa cttattggaa aaagggaaaa caattggttt gatagctgaa       180
     tgtaaagatt tgggtcttgg agaaaatggt tatacaatat tacaaaatac tgtagtttct       240
     ttagaatata gtgttataaa tgaaataatt aaaattactg ataatcatat aataatgaaa       300
     catttaatca agaataggct atataacaac tcgatattac ccttaaaagg gattatagtc       360
     aaaattttcg gagacgtact tttagatatg ccttttatat ttaagggtag gaataattat       420
     gaaatagatt taactaagaa tattttagat aagtactata tattttacct tgatagtgat       480
     attgagatta agccaggaga aacttataat tatgaatatg agttctatct aaagtatttt       540
     cctcctatgg attactttat cacagaatct gtaaattatg ttatgacata tagtgctaaa       600
     acttacttaa ctaaaaacga gaaaagagta ataaaatcag ttaggctaga gtatccactt       660
     gatgtcaaaa taatagaaga aaagcaagga aaaacatttc atgaagtgaa gattatcaaa       720
     ttgccaagtt gtagatcaat taaattctgg tttcatatat aa                          762
//

If you have problems or comments...

PBIL Back to PBIL home page