(data stored in ACNUC7421 zone)

EMBL: CP001402.PE669

CP001402.PE669       Location/Qualifiers
FT   CDS_pept        636583..637698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0688"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0688"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41305"
FT                   /db_xref="GOA:C4KF89"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF89"
FT                   /protein_id="ACR41305.1"
FT                   /translation="MYRVIELGHVISVPFAGEILRHLGFEVIKVEPLLGDPSRADDVLG
FT                   DSMFIFNNRGKRSISIDLKKDKGREVFLKLIENSHVLIENLSPYAMDRLGLSDDVIFST
FT                   NPSLIYCSVKGYPKGKYENLPAFGTVIEAESGIMDANGKARLPASITDMNASTYCVITI
FT                   LWALLMKKPGHYRVDIIQTNTVWLGYYFIAFQKYGKLFEGGKDELPFWAPYELFKSSEG
FT                   KEFYLAVNDNIKFTKLCKALGLDDLLVDGRFKTNADRVTNRKILHEKLQQKFSSMKLEE
FT                   IINILRYNDIPIGKLNNVKDLVSNELVEWDIFGNVKIPSLPLPGSLNNQDVPDLGEDTL
FT                   NILKELEYSENEIEDMIKENIIMPNRGEKKA"
     atgtataggg ttattgagtt aggacatgta atttcagtac catttgcagg agagattttg        60
     aggcatttag gatttgaggt aataaaggtg gaaccactac taggtgatcc aagcagggca       120
     gatgatgttt taggagattc gatgtttatc ttcaataata gaggtaaaag atccatttcc       180
     atagatttaa aaaaggataa gggaagggaa gttttcctaa aactaataga gaactcccat       240
     gttttgatag agaacttatc tccttatgcc atggatagac taggattatc ggatgatgtt       300
     atattttcaa ctaatccttc cttaatatat tgctctgtga agggatatcc taagggaaaa       360
     tacgaaaact tgcctgcttt tggtactgta attgaagcgg aaagcggaat catggatgct       420
     aatggaaaag ctagactacc ggcttcaata accgatatga atgcgtccac atattgtgta       480
     attacgattt tatgggcact gcttatgaag aaacccggac actatagggt agacattatt       540
     caaaccaata cagtttggtt aggatattat ttcatagcat ttcagaaata tggtaagctc       600
     tttgaaggag gaaaagacga acttcccttc tgggctcctt acgagctatt caaaagttct       660
     gagggaaagg aattttatct agccgtaaat gacaatataa aatttacaaa actttgtaag       720
     gcattaggat tagacgatct attggttgat ggaaggttta aaactaatgc ggatagggtt       780
     acgaatagaa aaatattaca tgaaaagctt caacagaaat tcagctcaat gaaactggaa       840
     gagataataa acattttacg ctataatgat atacccatag gtaaactaaa taatgtaaaa       900
     gatctagtta gtaatgaatt agtggaatgg gatatatttg gaaacgttaa gattcctagc       960
     cttcctctac cggggagtct gaataaccaa gatgtaccag atttagggga agatacttta      1020
     aatatattaa aggagcttga gtattcagaa aatgaaatag aagatatgat taaggaaaat      1080
     ataattatgc caaatagagg agaaaagaaa gcataa                                1116
//

If you have problems or comments...

PBIL Back to PBIL home page