(data stored in ACNUC7421 zone)

EMBL: CP001402.PE67

CP001402.PE67        Location/Qualifiers
FT   CDS_pept        59070..60575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0067"
FT                   /product="carbohydrate kinase, YjeF related protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40703"
FT                   /db_xref="GOA:C4KJI3"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJI3"
FT                   /protein_id="ACR40703.1"
FT                   /translation="MISVKEMRALEINSSALGVSTLILMENAGRSVKDEIVKRFNVKDK
FT                   VAYVYVGHGGKGGDGLVAARHLADEGAKVTVILLGENKHEDAILNLNVIEEMDYSITLV
FT                   EIKDMDELKPISADILIDAMLGTGFSGKPREPFRSAIKAFNNSKGFKVSIDVPSGINAD
FT                   TGEAYEDEYVKPDLVVTFHDIKPGLLKYNFNTVVTKIGIPVEAQIYVGPGDLIVNVHSR
FT                   PYYSKKGDSGRVLVIGGSYTFSGAPTLAAMGALRAGADLVYVASPEDTARIIAGYSPDL
FT                   ITIKLRGKNISPDNFEELKSWIDRADVVVIGPGMGLAEETIEASKLIVNYVKEKNKLAV
FT                   IDADALKAISGFDLYENAVITPHAGEFKIFFGEEPNKNIRDRIRQVIRYAKKCKCTVLL
FT                   KGYVDIISDGKRFKLNKTGNPGMTVGGSGDTLTGITATLMAQKIEPFIAAYLGVFINSL
FT                   AGTLAYNRLGAHLTPTDIINEIPNVINNPLDSFKRKLYKRVLS"
     atgatttcgg taaaagaaat gagggctttg gaaataaata gttctgcttt aggcgtgtct        60
     acattaatac tcatggagaa tgcaggtaga tccgttaaag acgaaatagt aaagagattt       120
     aacgtaaagg ataaggtagc atatgtttat gtaggacatg gtggaaaagg tggtgacggg       180
     ttggttgcgg cgagacattt agccgatgaa ggtgctaagg taaccgtaat tttattggga       240
     gaaaataaac acgaggatgc aatccttaat cttaatgtca tagaagagat ggactattca       300
     ataacgttag ttgagataaa ggatatggat gaactaaagc caatctctgc tgatatttta       360
     atcgatgcca tgttaggtac gggattctct ggaaagccaa gagaaccgtt tagaagtgcg       420
     ataaaagcgt tcaacaatag taaagggttc aaggtttcta tagacgttcc ctccgggata       480
     aatgctgata ctggtgaagc atatgaagac gaatatgtta aaccggatct ggttgtcacg       540
     tttcacgata tcaaacctgg cttattaaag tataatttca atactgtggt tacgaaaata       600
     ggtattccag tagaagccca aatatatgtt gggccagggg atttgatagt taacgtgcat       660
     agtagacctt attactctaa gaagggtgat agtggaagag tactagtaat tggaggaagt       720
     tacactttta gtggtgctcc aactctagcc gctatgggtg ctttgagagc tggagctgac       780
     ctagtttatg tagcatcacc agaggatacg gctagaatta tagcaggata ctctccagac       840
     ttaattacaa taaaattaag gggaaagaac atttctccag acaattttga agaattgaaa       900
     tcatggatag atagagcaga cgtagtggtt ataggtccgg gaatgggtct agctgaggag       960
     actattgagg cttctaaact aattgtgaat tatgttaaag agaagaataa gctagctgtt      1020
     attgatgctg atgcacttaa ggcaataagt gggttcgatt tgtatgaaaa tgctgtaata      1080
     acacctcatg caggcgaatt caagatattc tttggagaag aaccgaataa gaacataaga      1140
     gatagaataa gacaagtaat tagatatgct aagaaatgta aatgtacggt tctacttaag      1200
     gggtatgttg atataataag tgatggtaaa aggtttaaat taaataaaac tggtaacccg      1260
     ggtatgaccg tgggagggag cggggatacg ttgactggta taacagcaac attaatggct      1320
     caaaaaatcg aaccatttat agccgcatat ttaggggttt tcataaatag cctagctgga      1380
     actttagcat ataataggct cggagctcat ttgacaccta ctgatataat aaatgaaatt      1440
     ccaaatgtga taaataatcc cttggattct ttcaaaagaa aattgtataa aagagtttta      1500
     agttga                                                                 1506
//

If you have problems or comments...

PBIL Back to PBIL home page