(data stored in ACNUC7421 zone)

EMBL: CP001402.PE671

CP001402.PE671       Location/Qualifiers
FT   CDS_pept        complement(638697..639023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0690"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0690"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41307"
FT                   /db_xref="GOA:C4KF91"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF91"
FT                   /protein_id="ACR41307.1"
FT                   /translation="MLVRVCSLLDLEDKKPRKFSINGIEVAIVRVGDKVFAIDAYCPHK
FT                   GRNMEYGDVDGYKIRCDLHGYEYSLENGELVLNPYGKSSGWYFSSNLRIYKVEVKNKDI
FT                   FIQI"
     atgttagtga gagtctgtag cttattagat ttagaagata aaaaacccag aaaattctca        60
     ataaatggca tagaagtagc catagtaagg gttggtgata aagtgtttgc tattgatgcc       120
     tattgccctc ataagggaag aaatatggag tatggagatg tggacggata taaaataaga       180
     tgtgatttac atggatatga gtatagtctt gaaaacgggg aattagtatt aaatccttac       240
     ggaaagtcgt caggatggta cttttcatct aacttaagga tttacaaagt tgaggtaaag       300
     aacaaagaca ttttcataca aatttaa                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page