(data stored in ACNUC7421 zone)

EMBL: CP001402.PE672

CP001402.PE672       Location/Qualifiers
FT   CDS_pept        complement(639078..639644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0691"
FT                   /product="Ferritin Dps family protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0691"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41308"
FT                   /db_xref="GOA:C4KF92"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR014490"
FT                   /db_xref="InterPro:IPR033921"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF92"
FT                   /protein_id="ACR41308.1"
FT                   /translation="MQEKPQEPKVVGVEILEKSGLDVKKLVDKLVKATAAEFTTYYYYT
FT                   ILRMHLTGMEGEGLKEIAEDARLEDRLHFELMTQRLYELGGGLPRDIRQLADISACSDA
FT                   YLPENWKDPKEILKVLLEAEQCAIRTWKEVCDMTYGKDPRTYDLAQRILQEEIEHEAWF
FT                   LELLYGRPSGHFRRSSPGNAPYSKK"
     atgcaagaaa aaccccaaga accaaaggta gtcggagtag aaatactgga aaaatctgga        60
     ttagatgtga aaaagttagt agataaactt gttaaagcaa cagctgcaga gttcactaca       120
     tattactact ataccatatt gagaatgcac ctaactggta tggaaggaga gggtcttaag       180
     gaaatagctg aggatgctag gcttgaggat aggcttcact tcgaactaat gactcaaagg       240
     ctttatgaac taggaggagg tttacctaga gacataagac agcttgccga tatttcggct       300
     tgttctgatg catatctacc agagaattgg aaagacccta aagaaatatt aaaggttttg       360
     ttagaagccg aacagtgtgc gataagaact tggaaagaag tatgcgatat gacctacgga       420
     aaagatccta gaacttatga tctagcgcag agaatacttc aggaggaaat agaacacgaa       480
     gcgtggttct tagaattact atacggaagg ccatcgggtc acttcagaag aagctcacca       540
     ggtaacgctc catattctaa aaaataa                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page