(data stored in ACNUC7421 zone)

EMBL: CP001402.PE676

CP001402.PE676       Location/Qualifiers
FT   CDS_pept        643930..644673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0695"
FT                   /product="beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41312"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C4KF96"
FT                   /protein_id="ACR41312.1"
FT                   /translation="MMIFRQIISKSGGCATYIFGCTQAGELFVVDPRYEMVDEIVRLAQ
FT                   DLGNMKIAYIIDTHTHADHLSGVKKLQALTNANIYYHEESQVKFKVERIKDGEEIKAGN
FT                   VKIKVIHTPGHTPDSISVLVYDKRRDDSWNEPWAVLTGDTLFVGGVGRIDIGGENAEEN
FT                   LYYSLAKLKGLPDYVEIYPTHTAGSVCGVGISGKPSSTIGFEKRFNTLFRINEKDEFIN
FT                   RVREVKISKPKEFDEYIRKNLEGVI"
     atgatgatat tcaggcaaat tataagcaaa agtggtggtt gtgctactta tatctttggc        60
     tgtactcaag ctggagaatt gtttgtagtc gatcctaggt acgagatggt agatgaaata       120
     gttagattag ctcaagactt aggtaatatg aagatagctt atataataga cacacacact       180
     cacgctgatc acttatctgg tgtaaagaaa ttgcaagcat taactaacgc taatatttac       240
     tatcatgagg agtcacaagt caaatttaag gtagagagga ttaaggatgg agaggagata       300
     aaggcaggaa atgtgaagat aaaggtaatt catactcctg gacatactcc agatagcatt       360
     tcagttctag tatatgataa aaggagggat gacagttgga atgagccgtg ggctgtatta       420
     actggggata ctttgttcgt aggaggtgtt ggaagaattg atataggtgg ggaaaatgcg       480
     gaggagaatt tatactatag tctagccaag ctgaaaggat tgccagatta tgttgaaatt       540
     tacccaacac atactgccgg ttcagtatgt ggtgttggga taagtggaaa acctagttcc       600
     acaataggct ttgaaaagag attcaatact ttatttagaa taaacgaaaa agacgagttc       660
     ataaatagag ttagagaagt taaaatttct aagcccaaag agtttgatga gtatataagg       720
     aagaatttag aaggtgtaat ttga                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page