(data stored in ACNUC7421 zone)

EMBL: CP001402.PE680

CP001402.PE680       Location/Qualifiers
FT   CDS_pept        complement(647855..649693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0699"
FT                   /product="thiamine pyrophosphate protein domain protein
FT                   TPP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0699"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41316"
FT                   /db_xref="GOA:C4KFA0"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR017721"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFA0"
FT                   /protein_id="ACR41316.1"
FT                   /translation="MIELSTTKRVILGNEAIAFGALSAGVSIAAGYPGTPSTEIIETLM
FT                   AYGKIYTEWSANEKVAFETAYGAAINGAFALTTMKHVGLNVAADPLMSSSYTGVEGALV
FT                   IVSADDPSMWSSQNEQDNRYYGLHALIPVIEPYDPQSAHDLTIEAFKLSNKVKHPVILR
FT                   STTRIGHIRGPVELKPPSRPILGKLIKDPKRYVLVPENARRNRVEQLKRWEKIEEEVEG
FT                   LNGLIDNDSENLIIASGISFGYVIDAMKELDIKANVLRLSTPVPIPKRLFLKAVSNSKR
FT                   VLIVEEGEPIVEYQIKDLLYDQGIRVELHGKDLVSRVGEMTLDKVYYAFSKFFGLDLVT
FT                   EYLEVPQDIPPRPPALCPGCPHRSSFTDLKKAITMASFKPNETFISGDIGCYTLGLLPP
FT                   FDTQDSSTDMGSSIGIANGVYRATGNIPIAVIGDSTFFHSGISALANAVYTQTPMLVLV
FT                   LDNRSTAMTGQQPSPSKEIDIGEVAKGLGVKYVKYVDPFDVNSSIKELSNALKWVRENK
FT                   QPAVVIAKRACALLVMDNVEENNLPKAIVDLEKCTGCSICYDYFTCPAIIPRKDKKAEI
FT                   DNYTCIGCGACIPVCPFKAISLKGNKPEKWDELWLG"
     gtgattgaac tttctacaac taagagagta attttgggaa atgaggcaat agcttttggt        60
     gcattaagtg ctggagtatc catagctgca ggatatccag gcacaccatc tacagaaata       120
     atagaaactt taatggcata tggaaaaata tataccgaat ggagtgctaa cgaaaaagtg       180
     gcgtttgaaa cggcttatgg agcggctatc aacggagctt ttgccctaac tacaatgaaa       240
     catgtggggt taaacgtggc agctgatcct ttaatgagct catcatatac tggagtcgaa       300
     ggagcattag tcatagtttc tgccgatgat ccttccatgt ggtcatcaca aaacgaacaa       360
     gataacagat actacggttt acatgcgtta atcccagtta tagagccata tgatccacaa       420
     tctgctcatg acttaaccat agaggccttt aagctaagta acaaagttaa acatccagta       480
     attcttagat caactaccag aataggtcac attagaggac cagtagaact taagcctcca       540
     tctcgaccaa tcctgggtaa acttatcaaa gaccctaaac gttacgtgtt agtcccagag       600
     aacgctagaa gaaatagagt tgaacagtta aagagatggg aaaaaattga agaagaggta       660
     gagggtttaa atgggctaat tgacaacgat agtgaaaatc taataattgc ctcgggtatt       720
     tcattcggtt acgtaattga tgccatgaaa gagttggaca ttaaggcaaa tgtattaagg       780
     ttatccaccc ccgtccctat acctaaaaga ctgtttctca aggctgtaag caactccaag       840
     agggttctaa tagtagagga aggtgagcca attgttgaat atcaaataaa ggatctgctg       900
     tatgatcagg ggataagagt tgaattacat ggaaaggatc tagtaagtag agttggagag       960
     atgacattag acaaggtata ctatgctttt agcaaattct ttgggttaga ccttgtaacg      1020
     gaatacttag aagttcccca agatatacca ccaagacctc cagcactatg cccaggatgt      1080
     ccacacagaa gttcattcac agacttaaag aaggcaatca caatggcttc ctttaagcct      1140
     aatgaaacgt tcatctctgg tgatattgga tgttatacat taggattgtt accacccttc      1200
     gacactcaag actcttctac cgatatgggt tctagtattg ggattgccaa cggcgtttat      1260
     agggccactg ggaatatacc gatagcagtt attggagatt ctacattctt ccacagcggg      1320
     atttcagcac ttgcaaatgc tgtctatact caaactccta tgctcgtgct tgtcttagat      1380
     aataggtcta ctgcgatgac cggacaacag ccaagcccat ctaaggaaat agatatagga      1440
     gaggttgcta agggtttagg agtaaagtat gtaaagtacg ttgatccttt tgacgttaat      1500
     tcttcaataa aggaattatc aaatgcatta aagtgggtta gggaaaataa gcaaccggca      1560
     gttgtcatag ctaaaagagc ttgtgcgtta ttagttatgg ataacgtaga ggagaacaat      1620
     ctaccaaagg ccatagttga tctagagaaa tgtaccggtt gcagcatatg ctatgactac      1680
     tttacgtgcc ccgccataat tcctagaaag gataagaagg ctgagataga taattatacg      1740
     tgcataggct gtggggcttg tataccagtt tgcccattta aggcaatatc cttaaagggt      1800
     aacaaaccag aaaaatggga cgaattatgg ctagggtaa                             1839
//

If you have problems or comments...

PBIL Back to PBIL home page