(data stored in ACNUC7421 zone)

EMBL: CP001402.PE681

CP001402.PE681       Location/Qualifiers
FT   CDS_pept        650024..650206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0700"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41317"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFA1"
FT                   /protein_id="ACR41317.1"
FT                   /translation="MNDPKFLNSLPKLIIVSELLNIEIDTNNLEKLVKASNDIAVDLSI
FT                   GITKGENLVMIKLRR"
     gtgaatgacc cgaaattctt gaatagcctt cctaaattaa taatagtgag cgaattattg        60
     aatattgaga tcgatacaaa taacttggaa aagcttgtaa aagcatcaaa tgatattgca       120
     gtagatctat ccataggaat tacaaaagga gaaaatttgg taatgataaa actaagaaga       180
     taa                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page