(data stored in ACNUC7421 zone)

EMBL: CP001402.PE683

CP001402.PE683       Location/Qualifiers
FT   CDS_pept        650960..651169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0702"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0702"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41319"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFA3"
FT                   /protein_id="ACR41319.1"
FT                   /translation="MISFASAKEILNLRENSNIAVKLMRRVEDVCIFLSSSTLYGMIPC
FT                   NVELDMNTEYIYKGENVFEKISQP"
     atgataagct tcgccagtgc taaggaaata ttgaatttaa gagaaaactc aaatatcgca        60
     gttaaactta tgcgtagagt tgaagatgtc tgcatatttt tatccagtag tacgttatac       120
     ggaatgattc cttgcaatgt tgagttggat atgaatacag aatacatata taagggtgaa       180
     aatgttttcg aaaaaatcag tcaaccttga                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page