(data stored in ACNUC7421 zone)

EMBL: CP001402.PE684

CP001402.PE684       Location/Qualifiers
FT   CDS_pept        complement(651156..651590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0703"
FT                   /product="protein of unknown function DUF35"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0703"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41320"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFA4"
FT                   /protein_id="ACR41320.1"
FT                   /translation="MSWEKSGKEGRLLRWYDVMEAEKYEYTVGPAGEQFFNGLKQGKIV
FT                   GSKCSKCGRIFVPARSYCEHCFVKIENYVEVNKDEAYVDSYTIIYNDDEGNKLAQPVFI
FT                   ALIRFPNVEGGLLCYAEGNVKVEAKAKITSFQWPLRVKVD"
     atgtcttggg agaagagtgg aaaagaagga aggctattaa gatggtatga cgtaatggaa        60
     gctgaaaaat acgagtatac agtaggccca gcgggagaac agttctttaa cgggctgaaa       120
     caaggtaaga ttgtaggaag taagtgtagt aagtgtggaa gaatcttcgt ccctgctaga       180
     tcctattgtg aacactgctt cgtcaagata gagaattacg tggaagtaaa taaggatgag       240
     gcctacgtgg attcgtatac aataatctac aatgatgatg aaggtaacaa attagcacaa       300
     ccagtgttta ttgccctaat tagatttcca aatgttgaag gaggattgct gtgttacgct       360
     gaaggaaatg ttaaagtgga ggcaaaggct aaaattacga gctttcaatg gcctctacga       420
     gtcaaggttg actga                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page