(data stored in ACNUC7421 zone)

EMBL: CP001402.PE685

CP001402.PE685       Location/Qualifiers
FT   CDS_pept        complement(651591..652088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0704"
FT                   /product="protein of unknown function DUF35"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0704"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41321"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFA5"
FT                   /protein_id="ACR41321.1"
FT                   /translation="MVTPLKEEDLSKHYILSYKPNAKYAYTAGQAQSKYLLGLKEGKIY
FT                   GRKCNKCGRIHVPPKMYCEECFRPTDEWVEVKDEGIVMTAVASFISWTRAKLEEPEIVG
FT                   VIRLLPSNDRDFVYPGIFHRICASYEQVKSMEIIGKRVKAVWKPKEERKGSIEDIQCFK
FT                   VI"
     atggtaactc ctctaaaaga agaagactta agcaaacatt atatactctc atataaacca        60
     aacgctaaat acgcatacac tgcaggacag gctcagagca aatatctact tggacttaag       120
     gaaggaaaaa tttatggaag gaagtgcaat aagtgcggta gaattcacgt accgccaaaa       180
     atgtattgtg aggaatgctt tagacctact gacgagtggg ttgaagttaa agatgaagga       240
     atagtaatga ctgcagttgc tagcttcata agttggacta gagctaagtt ggaagagcca       300
     gagatagtcg gggttataag gctattacct tctaacgata gggatttcgt ataccctgga       360
     atattccaca gaatatgtgc aagttatgaa caagtgaaga gtatggaaat catagggaag       420
     agggttaagg cggtgtggaa gccaaaggag gaaaggaaag gaagtattga agatatccaa       480
     tgctttaagg tgatctaa                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page