(data stored in ACNUC7421 zone)

EMBL: CP001402.PE688

CP001402.PE688       Location/Qualifiers
FT   CDS_pept        complement(654484..655599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0707"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0707"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41324"
FT                   /db_xref="GOA:C4KFA8"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFA8"
FT                   /protein_id="ACR41324.1"
FT                   /translation="MSEKELFIESLREFLKRDVEKIATKIDKEDYYPRDLVRKLGELGF
FT                   LIPLTNGLSHYDMMIILEEIAKVSGSLALIADAQGELAGEMIRLYADERQRKEFLEPMS
FT                   KGEMIGSFALTEPSGGSDIGSMKTFAEKRNGLWRIKGHKMWITQGLYADIFVTVTRTGS
FT                   SRHDLSVFIVPRGNCVETRKIEVMGNRGTGTAEVIFHDCEVSKDYVVGEVNNGWNMVNS
FT                   VLEIGRLAISGIAIGLAEAALEEALKWARSRTAFGNSIYDFQGIRWYFADSVAKLNAVK
FT                   SMAKDVSNKFDENSKDKGVYVAMLKLLSAIIANEIVDISLQVFGGMGYAKGTTIERIYR
FT                   DARLLRIGEGTDEVQRHIIAKYIERYGIPYI"
     atgagcgaaa aagagctttt tatagaatca ctgagggaat tcctcaaaag agatgttgaa        60
     aaaatagcaa ctaaaataga caaagaagat tactacccta gagatttagt taggaaactc       120
     ggagagttag gctttctaat ccctttaact aatggacttt cacactacga tatgatgata       180
     attttagaag aaattgccaa ggttagtggg tccttagcgt taattgctga cgctcaagga       240
     gaattggctg gcgaaatgat tagattatat gcagacgaaa gacaaaggaa ggagtttcta       300
     gaaccgatga gtaagggaga gatgataggt agttttgccc taactgaacc ttctggtgga       360
     agtgatatag gctccatgaa gactttcgct gagaaaagaa atggattatg gagaataaaa       420
     ggacataaga tgtggataac tcaaggactt tacgctgata ttttcgtcac agttacgaga       480
     actggctcat ctaggcatga tttatccgtt ttcatagtgc ctaggggtaa ttgcgttgag       540
     actagaaaaa tagaagtcat gggtaatagg ggaactggaa ctgctgaggt aatctttcat       600
     gattgtgaag tgtcaaaaga ttacgtagtt ggagaagtaa ataatgggtg gaatatggta       660
     aattcagtac tagagatagg gagacttgct atatctggga ttgcaatagg tttggctgag       720
     gctgcgttgg aagaagctct taagtgggct agatctagaa cagcatttgg caattcaatt       780
     tatgattttc aagggataag atggtacttc gccgattccg tagctaaact caacgcggta       840
     aaatcaatgg ctaaggatgt tagcaataag tttgatgaga attcaaagga taagggagtt       900
     tacgtagcaa tgttaaagct attatcggcg attatcgcta acgaaatagt cgatatctcc       960
     ttgcaagtat ttggtggtat gggttacgct aagggaacca ctattgaacg aatatatcgt      1020
     gatgccagat tacttaggat aggtgaggga actgatgaag tacaaagaca cattattgct      1080
     aaatatattg aacggtatgg aataccgtat atttag                                1116
//

If you have problems or comments...

PBIL Back to PBIL home page