(data stored in ACNUC7421 zone)

EMBL: CP001402.PE690

CP001402.PE690       Location/Qualifiers
FT   CDS_pept        complement(657560..658192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0709"
FT                   /product="Bacterio-opsin activator HTH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0709"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41326"
FT                   /db_xref="InterPro:IPR007050"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFB0"
FT                   /protein_id="ACR41326.1"
FT                   /translation="MINLIKHVDIVVSHEDCWTSHMPFTAYTINLEVYPHKNYLRSRIL
FT                   IDSMENKVISNLMKTHRSVIKVMKVDRFKGGTYVDFLNKYKGSIAGVLYDKEVLILGNL
FT                   IEGKDEKWSFATSSKNLREILTEIESLGKVKRVETTDFNPILYPNLTEWEKKVLTVSYS
FT                   YGYLDYPRRATADELAKLLGISKVTFLYHLRNAQRKLIAFSIKNILA"
     atgattaact tgattaaaca tgtagatata gttgtaagcc atgaagattg ttggacttca        60
     cacatgccat ttaccgcata tactattaat ttagaagttt atccacataa gaactattta       120
     aggagtagga ttcttatcga ttcaatggaa aataaggtta tatcaaactt aatgaaaaca       180
     cacagaagcg ttataaaggt tatgaaggta gataggttta agggaggaac ttatgtggat       240
     tttttaaata aatacaaggg atcaatagct ggggtcctct acgataagga agtgttgatt       300
     ctgggtaatc tcatagaagg taaagacgaa aaatggtcat ttgcaacttc cagcaaaaat       360
     cttcgagaga ttcttactga gatcgaaagt ttaggaaagg tgaaaagagt ggagacaact       420
     gactttaacc caattctcta ccctaatctg actgaatggg aaaagaaagt gcttacggta       480
     tcctattcct atggttattt agactatccc agaagagcaa ctgccgatga attagctaag       540
     ctactaggaa taagtaaagt aacgttcctc tatcacttga gaaatgccca aaggaagtta       600
     attgcgtttt ccataaaaaa cattttagct tag                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page