(data stored in ACNUC7421 zone)

EMBL: CP001402.PE692

CP001402.PE692       Location/Qualifiers
FT   CDS_pept        659858..660325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0711"
FT                   /product="flavin reductase domain protein FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0711"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41328"
FT                   /db_xref="GOA:C4KFB2"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFB2"
FT                   /protein_id="ACR41328.1"
FT                   /translation="MSETIRNIMRLFPLGIVVVTTKWSDNLVGMTVNTFNSLSLNPPLV
FT                   MFTADKTKGNDVPFIESNGFIVNFVDDEKIFNTFAFKPVKERFKEVKFFEGLDGIPVLA
FT                   DSYAYMEVKKYKTIDIGDHTIVVGEVINGKVVRDNFSPLVYYNRNYWKLCR"
     atgagcgaga cgataaggaa tataatgaga ttatttccgc taggaatagt agtagttaca        60
     actaaatgga gtgataattt agtaggaatg acggtcaaca catttaattc gctttcttta       120
     aatccaccat tagttatgtt taccgcagat aaaactaagg gtaatgatgt accttttatc       180
     gagagtaatg gttttatagt aaattttgtc gatgacgaaa aaatcttcaa tacatttgcc       240
     tttaagcccg taaaggagag attcaaggag gtaaagttct tcgaaggttt agatggaata       300
     cccgtattgg ctgacagtta cgcttacatg gaagttaaga agtataagac tattgatatt       360
     ggtgatcaca ccattgtagt tggtgaggta attaatggaa aggttgttag agataatttc       420
     tcacccttag tctattacaa tagaaattat tggaagttat gtagataa                    468
//

If you have problems or comments...

PBIL Back to PBIL home page