(data stored in ACNUC7421 zone)

EMBL: CP001402.PE695

CP001402.PE695       Location/Qualifiers
FT   CDS_pept        662852..663625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0714"
FT                   /product="Extradiol ring-cleavage dioxygenase class III
FT                   protein subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0714"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41331"
FT                   /db_xref="GOA:C4KFB5"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR014436"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFB5"
FT                   /protein_id="ACR41331.1"
FT                   /translation="MTIGLFISHGSPTILIDENKWKDLLRKVGKEIEEKYKPETIIVSS
FT                   PHFVSWTETFYIESSEKLECIQDYYGFPDETYKYCYNALNDTELVEEIVKNAEGKVVKD
FT                   DKWGLDHGAWIPLFYMFPEYKPKVVTISITDNSPESHYEIGEKIRKAVEKLGRKAVFLA
FT                   TGSPTHRLDLFYFKITPKPTKFDAILMDLIKSGEFEKILKISELYPKEYQTAMPEGNLN
FT                   TLYMLLGYIKPKKAEILGYDTPWPGVSMLAASFYE"
     atgacaattg gcttatttat atctcatggt tctcctacaa tactgattga tgagaataag        60
     tggaaggact tattgagaaa agtaggaaag gaaattgagg agaagtataa accagaaaca       120
     ataatagtct caagtcccca tttcgtctca tggacggaaa ccttctatat tgaaagcagt       180
     gagaagctag agtgtattca agattattac ggtttcccag atgagactta taaatactgt       240
     tataacgcgt taaatgacac tgaactagtt gaagaaatag tgaaaaacgc tgagggaaaa       300
     gtagtgaaag atgataaatg gggattagat cacggtgcgt ggattcccct cttctacatg       360
     tttcccgagt ataaaccaaa agttgtgaca atatcaatta ctgacaattc gccagaatca       420
     cactatgaaa taggtgaaaa gattaggaaa gcagtagaga aacttggaag gaaagcagtg       480
     tttttagcca ctggttcacc aactcatagg ttagacttgt tttactttaa gataactcct       540
     aaacctacaa aattcgatgc gatattaatg gatctaataa aatctggtga atttgagaaa       600
     atattaaaaa ttagtgaact ttatcctaag gagtatcaga ctgcaatgcc agagggaaat       660
     ttaaatactc tatacatgct cttagggtat attaaaccaa agaaggctga gatactagga       720
     tatgatacac cttggcccgg agttagtatg ctagccgcaa gcttttatga gtaa             774
//

If you have problems or comments...

PBIL Back to PBIL home page