(data stored in ACNUC7421 zone)

EMBL: CP001402.PE696

CP001402.PE696       Location/Qualifiers
FT   CDS_pept        663694..663921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0715"
FT                   /product="DNA-directed RNA polymerase, subunit M (RpoM-2)"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0715"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41332"
FT                   /db_xref="GOA:C4KFB6"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFB6"
FT                   /protein_id="ACR41332.1"
FT                   /translation="MVCSKCGHSDHDVEKVILKENINHENDKTIIADGETIEGRVAISL
FT                   CPRCGSARAILLNKKKRLYRCMTCSFVYTI"
     atggtttgta gtaagtgtgg acattctgat catgatgtag aaaaagtgat attgaaggag        60
     aatataaatc atgaaaatga taagacaata atagcagatg gcgaaaccat agagggtaga       120
     gtcgctatct cgctctgtcc tagatgcggt tcggcgagag ctatattact taataagaag       180
     aaaagattat ataggtgcat gacgtgtagc tttgtttaca ctatttag                    228
//

If you have problems or comments...

PBIL Back to PBIL home page