(data stored in ACNUC7421 zone)

EMBL: CP001402.PE697

CP001402.PE697       Location/Qualifiers
FT   CDS_pept        complement(663918..664325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0716"
FT                   /product="Hemerythrin HHE cation binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0716"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41333"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFB7"
FT                   /protein_id="ACR41333.1"
FT                   /translation="MDLIELLKFEHGIFRIRFYFMEKVDNSLQELETLHDFIVNVHAKM
FT                   EDLYVFKDIPEAKPYSNDHKLIEKYGDTIIKEKRKDWVPRYMKIVLDHNLNEEKYVFPK
FT                   VKERKGLVLDIIEQYGFESYQKVTGIDIRNF"
     atggacttaa tagaactact taaatttgaa catggtatat ttagaataag attctatttt        60
     atggaaaaag ttgataattc tttgcaggaa ttggaaacat tacatgactt catagttaat       120
     gttcacgcga agatggagga cttgtatgtc tttaaagata taccagaagc caagccttat       180
     tcaaacgacc ataaactaat tgagaagtac ggtgatacga taataaagga gaagagaaaa       240
     gattgggtac ctaggtatat gaaaatagtg ttagatcata atctgaatga agagaaatac       300
     gtatttccga aggtaaaaga aagaaaaggt ttggtcttag acattataga acaatatggc       360
     tttgaaagct atcaaaaagt tactggtata gatataagaa atttctaa                    408
//

If you have problems or comments...

PBIL Back to PBIL home page