(data stored in ACNUC7421 zone)

EMBL: CP001402.PE698

CP001402.PE698       Location/Qualifiers
FT   CDS_pept        664390..664884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0717"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0717"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41334"
FT                   /db_xref="GOA:C4KFB8"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFB8"
FT                   /protein_id="ACR41334.1"
FT                   /translation="MKFSFLLLLIITVISKTFMLGNYIIYVNVNENFPLVQSVENSTIG
FT                   IKFVVSVKNFTVEPQTIDKLLAIKNSTNFSEIIVPYYLINETFSIVYNGSYYANITISS
FT                   VQVNDSNNFGGNLTNVSFISTSSSPLALNTFYSNGVIVMVLVATFSIVLYTILQNKKKR
FT                   K"
     atgaaattct catttcttct attactgata ataaccgtaa tttcgaaaac gtttatgcta        60
     ggcaattata taatatatgt taacgtaaat gagaattttc cattagttca aagcgttgag       120
     aactccacta ttggtataaa atttgtagta agtgtaaaga actttacagt agaacctcaa       180
     actattgata agttattagc aataaagaat agcaccaatt tctcggaaat aattgtacct       240
     tattatctga ttaacgaaac attctcaata gtttataatg ggagttatta tgcaaacatt       300
     acaataagct ctgtgcaagt aaacgacagt aataattttg gtggaaatct tacgaatgtt       360
     tcattcattt ctacctcttc atctccttta gccttaaaca ctttttacag taatggggtt       420
     attgtaatgg tactagttgc aacattttca atagtcttat atacaatttt gcagaacaag       480
     aagaagagaa aataa                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page