(data stored in ACNUC7421 zone)

EMBL: CP001402.PE70

CP001402.PE70        Location/Qualifiers
FT   CDS_pept        62629..63438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0070"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40706"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJI6"
FT                   /protein_id="ACR40706.1"
FT                   /translation="MRILVNGLLPLDSGKTTFSLSIIRLFNQVGIRLFPFKPIAGHNAW
FT                   YSFNTLIRSEELGILVGNDALKYYDETKYDIRRINPFAVLFVPIDLEKLSYNVSLYNMI
FT                   MEYGFPYLIRLSDCINGIDQYFVNSSADIYVPKSMLKFTRNLALKFNAKSYDKMREIID
FT                   ASPQLVDNCTIDVFRNYENVIIESYNDSASPTYNSADVDYVFTVSPTKAFLIKGEEFKK
FT                   ALSLFSIPPWNVRVSTLIKYLKIGKSFEIDVGERVAKDEILDILLKS"
     atgagaatac tagtaaacgg tctactacca ctggattcgg gtaagacaac attttcatta        60
     tccattattc gactatttaa tcaagtagga atcagattgt ttccattcaa gccaattgcc       120
     gggcataatg cttggtatag ctttaacact ctcataagga gtgaagagtt aggaatattg       180
     gttgggaatg atgctttaaa gtattatgat gaaacaaaat atgatattag gagaattaat       240
     ccatttgctg ttcttttcgt tcctatagat ttggaaaagc taagctacaa cgtatctcta       300
     tataatatga taatggagta tggatttcca tatttaataa ggttaagtga ctgcattaat       360
     gggatagatc agtattttgt aaacagtagt gcagatatat atgtgccgaa atcaatgctg       420
     aaatttacta gaaacctagc cttaaaattt aatgcaaaat catatgataa aatgagagag       480
     ataatagacg cttctccaca actagtagac aattgtacta tagatgtatt tagaaactat       540
     gaaaacgtga taatagagtc ctataatgac tcagcttctc ccacttataa ttcggctgac       600
     gtagattacg tgtttacagt ctcccctaca aaagcgtttc tcataaaagg tgaggaattt       660
     aagaaggcct tatcattatt ttcaatcccg ccatggaatg ttagagtctc cactcttata       720
     aagtatctaa aaatagggaa aagttttgaa atagatgtag gagaaagagt agctaaagac       780
     gagattctag atatattact caagtcttag                                        810
//

If you have problems or comments...

PBIL Back to PBIL home page