(data stored in ACNUC7421 zone)

EMBL: CP001402.PE701

CP001402.PE701       Location/Qualifiers
FT   CDS_pept        666950..667138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0720"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41337"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFC1"
FT                   /protein_id="ACR41337.1"
FT                   /translation="MLKFYLLRMISHADVGYAQKGESDYGDVSPVPLESHDPPKRWLRA
FT                   KYLHSIMNEHKMIEMKV"
     atgttaaaat tttatttatt aaggatgatc tctcacgccg atgtgggcta tgcccaaaag        60
     ggtgagagtg attacggaga tgtgagcccc gtgccgttgg agtcccatga cccacctaaa       120
     aggtggttga gggctaagta cctacactcg atcatgaatg aacataaaat gattgaaatg       180
     aaagtgtag                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page