(data stored in ACNUC7421 zone)

EMBL: CP001402.PE703

CP001402.PE703       Location/Qualifiers
FT   CDS_pept        667496..667915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0722"
FT                   /product="PilT protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0722"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41339"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFC3"
FT                   /protein_id="ACR41339.1"
FT                   /translation="MMIESDILLAHIKSEDRLKAVADTILLRIARGELKVIASREVFHE
FT                   LYYVLKNMNLSPQEILLRLGALKSIPNIDWVPTTVDTDLLALSLMSQYGISSIFDSYYV
FT                   ATCLLYDKDKIIISTDHIFDKVLGIRRIDPRDFVK"
     atgatgatag agagtgacat tctcttagcc catattaagt ctgaagatag acttaaagcc        60
     gtggccgata ctattctttt aagaattgct agaggagagt taaaagtaat cgcctccaga       120
     gaagtgtttc atgagcttta ctatgtttta aagaatatga atctatctcc gcaagaaata       180
     ctcctaaggc tcggtgcgtt aaagagtata cctaacatag actgggttcc cactactgta       240
     gatactgatc ttcttgcgct gtctttaatg tcccaatatg gaatatcttc aatattcgat       300
     tcttattatg ttgcaacttg cctcctatac gataaggata agataataat ttccacagat       360
     cacatctttg acaaagtcct tgggatcaga agaatagacc cgagagattt tgtcaaatga       420
//

If you have problems or comments...

PBIL Back to PBIL home page