(data stored in ACNUC7421 zone)

EMBL: CP001402.PE704

CP001402.PE704       Location/Qualifiers
FT   CDS_pept        668300..668449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0723"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0723"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41340"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFC4"
FT                   /protein_id="ACR41340.1"
FT                   /translation="MFRRLKTRLRKLIKKKPKDLNETEAIGILLEGMKTRKIAKILKVY
FT                   QHNL"
     gtgtttagga gattaaaaac gaggctcaga aaactgatca aaaagaagcc caaggaccta        60
     aacgagactg aggctatagg aatactattg gaaggaatga aaactaggaa aatagctaaa       120
     atactaaaag tataccagca caatttatag                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page