(data stored in ACNUC7421 zone)

EMBL: CP001402.PE706

CP001402.PE706       Location/Qualifiers
FT   CDS_pept        670374..670676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0725"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0725"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41342"
FT                   /db_xref="InterPro:IPR032603"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFC6"
FT                   /protein_id="ACR41342.1"
FT                   /translation="MPVISIEELSENIEDSLTKMISKSGSVKFVRHVSASLIVDAQKFF
FT                   KTFVPTAKYYIVIVPDNVKNEKVKDELISMSRNSFNFTILYSYKLRDEILIIGYD"
     atgccggtta tatcaattga ggagttatca gaaaatattg aggatagcct aactaaaatg        60
     ataagtaaaa gtggaagtgt gaagtttgtt aggcacgtta gtgccagttt gatagttgat       120
     gctcagaaat ttttcaagac ttttgtacct actgctaagt attatatagt gatagtgcca       180
     gacaatgtaa aaaatgaaaa agtaaaagat gagcttatat ctatgtcaag aaatagtttt       240
     aattttacaa tcctttattc ttataagctt agggatgaaa ttttaataat aggttacgat       300
     tga                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page