(data stored in ACNUC7421 zone)

EMBL: CP001402.PE707

CP001402.PE707       Location/Qualifiers
FT   CDS_pept        671057..671488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0726"
FT                   /product="death-on-curing family protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0726"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41343"
FT                   /db_xref="GOA:C4KFC7"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR006440"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFC7"
FT                   /protein_id="ACR41343.1"
FT                   /translation="MESKLRAIITSLSKTFIIWLNDRVLKEEDPSLTSIVINEGNIEGA
FT                   IYSALLDFEINHSISRSLAVLIHHLISGHPFADGNKRTATALLLTILSKLYERDIIIED
FT                   RLMKSLITVIAKIANETENEIRELQEIIGEIMRNLANPY"
     atggaaagta agttgagagc catcatcacc tcacttagta agactttcat aatatggcta        60
     aatgacagag ttttaaaaga agaagaccct tccctaactt ctatcgtaat taatgaggga       120
     aatattgaag gagctatcta ttccgcatta ctggactttg aaataaacca tagtataagt       180
     aggagtttag cagttttaat acatcacttg attagtgggc accctttcgc cgatggaaat       240
     aagagaaccg ctacagcatt gctacttact atactttcta agttatatga gagggatata       300
     ataattgaag atcgtctaat gaaatcgtta ataactgtga tagcaaaaat agctaatgaa       360
     acggaaaatg aaataagaga actacaagaa attatagggg agattatgag aaatttagct       420
     aatccttatt ag                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page