(data stored in ACNUC7421 zone)

EMBL: CP001402.PE71

CP001402.PE71        Location/Qualifiers
FT   CDS_pept        complement(63428..64096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0071"
FT                   /product="protein of unknown function DUF1641"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40707"
FT                   /db_xref="InterPro:IPR012440"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJI7"
FT                   /protein_id="ACR40707.1"
FT                   /translation="MTNGEFYALDNLLKDEKLNSLNKILDVINTTDRLGILDVIKGILE
FT                   DENTIGKIIGSLTSDDVLELLASWDKIIKTTKLFINDYNIYNIQFLINLIDKVRSRGIL
FT                   DPIIGLLEDEESLGKIINSLINDFTLSLINHWDEITNDLSRIDLTNFKYYTLLVSATGE
FT                   ALKTENVKPITSIWEIYKLLKDPDIQRGLGVAASVLKHIGKLYVPDKGLAFEAEKNSKT
FT                   "
     gtgactaatg gagaattcta tgctttagac aatttactga aagatgaaaa acttaacagt        60
     cttaacaaaa tcctagacgt aataaacact actgatagac ttggcatact tgacgtaatt       120
     aaagggatat tagaagatga aaacacaata ggaaaaataa tagggtcact tactagtgat       180
     gatgtcttag aattattagc gagttgggat aaaatcataa agaccactaa gttatttatt       240
     aatgattaca atatatacaa tatacagttc ttaataaatc ttatagataa agttaggagc       300
     agaggaattt tagaccccat aattggacta ttagaagatg aagaaagctt aggaaagata       360
     ataaattctc taataaacga tttcacatta agcctaatta accattggga tgagattact       420
     aatgatctgt caagaataga tctaactaac ttcaaatatt atactttatt ggtttctgca       480
     actggagaag ccttaaaaac cgaaaatgta aaacccataa ctagtatttg ggaaatttac       540
     aagttattaa aggatccaga tattcaaaga ggattgggag tagctgcatc tgtactaaaa       600
     cacattggaa aattgtacgt acccgacaag ggattagcct ttgaagcaga gaaaaactct       660
     aagacttga                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page