(data stored in ACNUC7421 zone)

EMBL: CP001402.PE711

CP001402.PE711       Location/Qualifiers
FT   CDS_pept        complement(676556..678406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0730"
FT                   /product="amino acid permease-associated region"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0730"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41347"
FT                   /db_xref="GOA:C4KFD1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFD1"
FT                   /protein_id="ACR41347.1"
FT                   /translation="MTSVSNSDKLLRKELGLLDLTFLSLSAMIGSGWLLASLSVASIAG
FT                   PSGVLSWIIAGIMVMFIGLAYAELGSSIPKTGGIVRYPVYSHGSYTGFVIAFLYLLSAI
FT                   STPSIEALATIEYLTSVNPTLSKLLTNSTVVNGTPVTILTPPGLLFSILLLFIYFIVNY
FT                   YGIKILGKTNSAITVWKLIIPVVTFILLFFAFKSSNFTNYGGLFPKSVASNYVGPVGML
FT                   YAIPSAGIIYSYLGFRQPIEYSGEAKNPEKNVWRAIILSIVIAILIYTFLQIAFIGAIN
FT                   WVSAGVTPGNWSALLNSKWANSPFYSELEAEGLAIAGAWGYVLLIDAVLSPSGTGLVYT
FT                   GTSARTLYGLSAEEYFPLIFKKLNSYRIPIWSLIVSLIASIIFLLPFPSWYLLVGFNSS
FT                   ATVLTYIMGGIGLQTLRKTAPDLKRGIKIPFASIIAPVATIVSLLIVYWSGFTTLFYII
FT                   SALFIGIPIFWINYSVKILGLKKWIGISLGISQLVVNIILTIIGYYSLVLNNDNPILYF
FT                   ALFILMALTPLVVAYLTVNTNEKVHLKSGFWLMGLIITIYIISYLSEFGPSSNSAPIRF
FT                   PYDIAIISIIGIIFHYLAVLSGFRTREIEEIIEDQKERRD"
     atgacaagcg tcagtaactc cgataagttg ttaaggaaag agttgggtct cttggatcta        60
     acctttttat ctttaagtgc aatgataggt tctggttggt tactagcttc cttaagcgtg       120
     gcatccatag cggggccatc tggagtttta tcttggataa tagctgggat aatggtaatg       180
     tttatagggt tagcttatgc cgaacttgga agttcaatac ctaaaactgg tggtatagtt       240
     agatatccag tttattccca cggaagttac actggatttg tcatagcatt tctatatctt       300
     ctctcggcaa tctctacacc ttctatagaa gctttagcaa caatcgaata cttaactagt       360
     gtaaacccca ctttgagtaa attgcttact aactcaacag ttgttaacgg cacaccagtt       420
     actatattaa cgccccccgg attactgttt tccattcttt tactatttat ctatttcata       480
     gtaaactatt acggtataaa gatcttaggg aaaacgaatt ctgcaataac agtttggaaa       540
     ttgatcatac cagttgttac atttatatta ctatttttcg catttaaatc aagtaatttt       600
     acaaattatg gaggattatt tccgaaaagt gttgcatcaa attatgttgg tccagttggt       660
     atgctgtatg caataccctc ggctgggata atctactcgt atttaggatt tagacaaccc       720
     atagagtatt ctggagaggc caaaaatcct gaaaagaacg tatggagagc cataattctc       780
     tcaatagtaa ttgccatact aatttacact ttcctacaaa tagcttttat aggtgcaata       840
     aattgggtat ctgctggagt aacaccaggc aattggtcag cattgctaaa tagtaagtgg       900
     gctaacagtc cattctacag tgagctggaa gctgaaggtc tagcaatagc tggagcttgg       960
     ggatatgtac ttttaataga tgcggttcta tctcccagtg gaactggact agtttatact      1020
     gggacatcag ctaggacgct ttacgggtta tcagcagaag aatatttccc actaatattt      1080
     aaaaaattaa atagctatag aatccctata tggtccttaa tcgtatcctt aatagccagt      1140
     atcatattcc tacttccgtt tccaagttgg tatttattag ttggattcaa ctcctcagct      1200
     actgtactta cgtatattat gggcggtata ggtttacaaa ccttgagaaa aacagcccct      1260
     gatttaaaga gaggaattaa gataccgttt gctagcataa tagcgccagt tgctacaata      1320
     gtttccttgc taatagtgta ttggtcaggg tttacaacat tgttttatat catctctgct      1380
     ttatttattg gaattccaat cttctggata aattattctg tgaagattct agggctaaag      1440
     aaatggattg gtattagctt aggaatatca caactagttg taaatatcat attaactata      1500
     atcggatatt atagcctagt tttgaataac gataatccta tactatactt tgcactattt      1560
     atattaatgg cgttaacacc cctagtagtt gcttatctaa ctgtaaacac taatgagaaa      1620
     gtacacctga agagtggatt ttggcttatg ggcttaatta ttacaattta cattatcagt      1680
     tatcttagtg agtttggacc atcgagcaac tctgctccta taagattccc ttatgatatt      1740
     gcaataattt cgataatagg tataatattc cattatttag ccgttttaag tggttttaga      1800
     accagggaaa tagaggaaat tattgaggat cagaaggaga gaagagatta a               1851
//

If you have problems or comments...

PBIL Back to PBIL home page