(data stored in ACNUC7421 zone)

EMBL: CP001402.PE720

CP001402.PE720       Location/Qualifiers
FT   CDS_pept        689556..690134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0739"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0739"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41356"
FT                   /db_xref="GOA:C4KFE0"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFE0"
FT                   /protein_id="ACR41356.1"
FT                   /translation="MIILWLRDENLNNCKAVHIHMDKKILIFIVLIVIISFALIMVYPS
FT                   KDLLFSPQEAEAIFGGNWEVLQNNTNLKSIGTITIYYANSTNLTTQHSLEVESIEEEVL
FT                   AGDVNNTKVEITIVIVKFSSNSSWSEIFGNNTNYYKYNGYYITYSATSFTYPKTIIVAY
FT                   KGSTLVEITLDGYQASFAQVKEILSYLNV"
     atgataatat tatggttaag agatgaaaat ttaaataact gtaaggctgt gcatatccac        60
     atggataaga aaatcttgat ttttatagta ttaatagtta taatatcttt tgctttaata       120
     atggtatatc cctcaaaaga ccttttgttc tctcctcaag aggctgaagc tatctttggg       180
     ggaaattggg aggttctgca aaacaatact aatttaaagt ctattggtac gataacaata       240
     tattatgcta atagtacaaa tcttactaca caacattcac tagaagtcga atcaattgaa       300
     gaagaagtac ttgcgggaga cgtaaataat actaaagtgg aaataactat agttatcgta       360
     aaattctctt caaatagtag ttggagtgaa atcttcggta ataataccaa ttattataaa       420
     tataacggat attacattac ttattcagct acttctttta cgtatcctaa aacaattata       480
     gttgcttata agggctcaac tttagtagaa ataaccttag atgggtatca agcttcattt       540
     gctcaggtaa aggagatatt aagctacttg aacgtttaa                              579
//

If you have problems or comments...

PBIL Back to PBIL home page