(data stored in ACNUC7421 zone)

EMBL: CP001402.PE721

CP001402.PE721       Location/Qualifiers
FT   CDS_pept        complement(690639..691604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0740"
FT                   /product="cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0740"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41357"
FT                   /db_xref="GOA:C4KFE1"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFE1"
FT                   /protein_id="ACR41357.1"
FT                   /translation="MNTLVDQIISWIIVLYGSAVPALFVIFLIGITGLREITRYETGNT
FT                   FLYKLNPVTKVVLTIVVMIVAATTIWWIGAILTLILLLSYLTLNDGVRKFGYAFFLALS
FT                   TILGGTWSIAPYTPPSTLQLAFPNVKQFTVIWTFPSYFQVMGYEQQLTLEALIYGLQTT
FT                   FRVAPVLLSALLFITTTTGSDIFRMFTKIKIPIAITFSVLVGIRMIPRIFELLDTSVKM
FT                   QYIRGLGYGRPKIVSSLLIVYAIFEAIIPTMVYLFRGAKNLAISADTRGFRAYPSRTSL
FT                   VELKFTRVDYYGTAIIAALIIIAIVANLLGFGRTIPYVGL"
     atgaacactt tagttgatca aataataagt tggataattg ttctctacgg atccgcagtg        60
     ccagctttat tcgtaatttt cttgatagga ataacaggtt taagggaaat aacgcgttat       120
     gagactggaa atacgtttct atataagtta aaccccgtta cgaaggtagt actcacaata       180
     gtagttatga ttgtagctgc tactacgata tggtggatag gcgccatatt aaccctaatt       240
     ctcttattat catatcttac gctaaacgat ggagtaagga aattcggata tgcgtttttc       300
     ttagcgcttt caacaatatt gggtggaacg tggagcattg ctccttacac tccacctagt       360
     acactacagt tagccttccc taatgtgaaa cagtttacgg taatttggac attcccatct       420
     tatttccaag taatggggta tgagcaacaa ttaacgttag aagctctaat ttacggcctt       480
     cagactacct ttagagtagc tccagtatta ttatcagcct tactgttcat tactacaaca       540
     actggatccg atatcttcag gatgttcact aaaataaaga tacctatagc aattacgttt       600
     tcagtgttag ttggcataag gatgatacct aggatatttg agctgttaga cacttcagtg       660
     aagatgcagt atataagagg tttagggtat ggtagaccga aaatagtttc ttcactgtta       720
     atagtttacg cgatttttga agcaataata ccaactatgg tgtatttgtt taggggagct       780
     aagaacttgg caatttcagc tgatactagg ggatttagag cttatccaag taggactagt       840
     ctagtagaac ttaagtttac aagagttgac tactacggta ctgcaataat tgcggcatta       900
     ataattatag caattgtagc taatttactt ggatttggga gaacgatacc atacgttgga       960
     ctttaa                                                                  966
//

If you have problems or comments...

PBIL Back to PBIL home page