(data stored in ACNUC7421 zone)

EMBL: CP001402.PE726

CP001402.PE726       Location/Qualifiers
FT   CDS_pept        complement(695374..695904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0745"
FT                   /product="Protein of unknown function DUF1286"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0745"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41362"
FT                   /db_xref="GOA:C4KFE6"
FT                   /db_xref="InterPro:IPR009705"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFE6"
FT                   /protein_id="ACR41362.1"
FT                   /translation="MNLVRLRTHYIFSTGLLTFLDSVLFHEYFYYALILSGIVSVIGNF
FT                   LIDRIGHKEVATRYGYIPVRTPLTHTIPRSVVWGVVSVVPVFILLLIYYYGFSYHEYYF
FT                   SLSNKVVLLILLNGVVVGPSHLFLDVFTERGIYVKKYGRWRRFALAHFRYDNPLVNGLA
FT                   IIAGAVMIYLAYL"
     atgaatcttg tgaggctcag aacccattac attttctcaa ccggtttatt gacgtttctg        60
     gactctgttc tctttcatga atatttttat tacgctttaa tcttgagcgg aatagtttcg       120
     gtaataggta atttcttgat tgataggatt ggccataagg aggttgccac taggtatggg       180
     tatattccag taaggacacc tttaactcat acaattccta gaagtgtagt ttggggtgtt       240
     gtctccgtag tcccagtctt tatcctctta ttgatttatt attatgggtt tagttatcac       300
     gagtactatt tctcccttag caataaggtg gtgttgttaa tattgttaaa cggtgtggtt       360
     gttgggccct ctcacttgtt cttggacgta tttacggaaa ggggaatata cgttaaaaaa       420
     tacggtagat ggaggaggtt tgcattagca catttcagat atgataaccc cttagtaaac       480
     ggtttagcaa taatagctgg tgccgtaatg atatatctgg cttatctctg a                531
//

If you have problems or comments...

PBIL Back to PBIL home page