(data stored in ACNUC7421 zone)

EMBL: CP001402.PE727

CP001402.PE727       Location/Qualifiers
FT   CDS_pept        complement(695901..696119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0746"
FT                   /product="zinc finger SWIM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0746"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41363"
FT                   /db_xref="GOA:C4KFE7"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFE7"
FT                   /protein_id="ACR41363.1"
FT                   /translation="MYPYLIGITRNTYYIAMESERNPLESYLVRIVYKDKSVINYSCSC
FT                   KGFAMRGKCKHIAIAKNKVRFISEERV"
     atgtacccat acttgattgg aataactagg aacacttatt acatagcgat ggaatctgag        60
     aggaacccgt tggagtcata cttagtaagg atagtgtaca aggataaaag cgtaatcaat       120
     tattcgtgta gttgcaaggg atttgcaatg agaggaaaat gcaaacacat agcaattgct       180
     aaaaataagg tgagatttat aagcgaggag agggtatga                              219
//

If you have problems or comments...

PBIL Back to PBIL home page