(data stored in ACNUC7421 zone)

EMBL: CP001402.PE728

CP001402.PE728       Location/Qualifiers
FT   CDS_pept        696363..696467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_2798"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_2798"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41364"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFE8"
FT                   /protein_id="ACR41364.1"
FT                   /translation="MARLPEEYLRNEFPEEWRSLQKEKKSYYGWIWYS"
     atggctagat taccagagga atacttgaga aatgagtttc cagaagagtg gcgttcattg        60
     caaaaagaaa agaaatctta ttatggttgg atctggtatt cctaa                       105
//

If you have problems or comments...

PBIL Back to PBIL home page