(data stored in ACNUC7421 zone)

EMBL: CP001402.PE729

CP001402.PE729       Location/Qualifiers
FT   CDS_pept        696677..696871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0747"
FT                   /product="DNA-binding 7 kDa protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0747"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41365"
FT                   /db_xref="GOA:C4KFE9"
FT                   /db_xref="InterPro:IPR003212"
FT                   /db_xref="InterPro:IPR016197"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFE9"
FT                   /protein_id="ACR41365.1"
FT                   /translation="MTTVKFKYKGEEKQVDISKIKKVWRVGKMISFTYDEGGGKTGRGA
FT                   VSEKDAPKELLQMLEKQKK"
     atgacaacag taaagttcaa gtataaggga gaagaaaaac aagtagacat aagtaagata        60
     aagaaggtat ggagagtcgg aaagatgata agcttcacct atgatgaggg tggaggaaag       120
     actggtagag gagcagtaag cgagaaagat gctccaaaag agctattaca aatgttagag       180
     aaacaaaaga agtaa                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page