(data stored in ACNUC7421 zone)

EMBL: CP001402.PE730

CP001402.PE730       Location/Qualifiers
FT   CDS_pept        697191..698492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0748"
FT                   /product="integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0748"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41366"
FT                   /db_xref="GOA:C4KFF0"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFF0"
FT                   /protein_id="ACR41366.1"
FT                   /translation="MRHSKLIYINYVDGYLLIMDTTKLDDDKKLKILEKAIEKFGKAYI
FT                   AQKCGVSRQTIYRYLKREIQSIPDEFIQCVSNFLSIEELGDIVYGLRTVEVDENIALSV
FT                   IVKMKRDPNFRAFFLSLMKQFLGEYIQDASTSYVITKNDVDRFLNYIKSKSNTTYKTFK
FT                   NYFVKTIAELNYTLTPEAVKDYITKEMTISKGRASHISKILKLFIKEIIIPKNSSLGRE
FT                   LYNSFKTIKVEKEYSPESLTLEDLKRVFTTIEHIGAKAFFLLLAETGLRINEILKLNID
FT                   QIDLEKRIIYVNKISASKRAYITFLHENTAKWLKETYLPYREEFINKYEKKLRNININV
FT                   EAWKNRLFPINEYNMRKEIKEAMKKVLSREFRLYDLRSFFASYMIKQGVSPMIVNLLQG
FT                   RAPPQQFQILQNHYFVVSDIELQQYYDKYAPRLL"
     atgcgacatt ctaaactaat atatataaac tatgtggatg gatatttatt gataatggat        60
     actacaaaat tggatgatga taagaaatta aaaatcctcg aaaaggctat tgaaaaattt       120
     ggaaaagcat atattgctca aaaatgcggt gtttcgaggc agacaattta ccgttatcta       180
     aaaagagaaa ttcaaagtat ccctgatgaa ttcattcagt gcgtttccaa ttttctctct       240
     atcgaagaat taggggatat cgtatatggg cttcgaactg ttgaagttga tgagaatatt       300
     gcattaagcg ttatagttaa aatgaaaaga gaccccaatt ttagggcgtt ttttctatct       360
     ctaatgaaac aatttctagg cgaatatata caagatgcat caacatctta cgttattaca       420
     aaaaatgatg tagatcgatt cttgaattac atcaaatcaa aaagcaacac tacgtacaaa       480
     actttcaaaa attattttgt gaaaactatt gcagagttga attacactct aacacctgag       540
     gcggtgaaag attatattac taaagaaatg accatttcaa aaggaagagc atcacacatt       600
     tcaaaaatct tgaaactttt tatcaaagag attataatac caaaaaacag ttctcttggt       660
     agagaactat acaactcatt caagacgata aaagttgaaa aagaatatag ccctgagtct       720
     ttaacgttag aagatctaaa aagagtgttc accacgattg aacacatagg tgctaaagca       780
     ttcttccttc tcttagctga aactggtcta agaataaatg aaatattaaa attaaatata       840
     gatcaaatcg atctggaaaa gcgtataatt tatgttaata agatatcagc atcaaaaaga       900
     gcatacatta cgtttttgca tgaaaatact gctaagtggc tgaaagagac ttatctaccc       960
     tatcgggagg agttcattaa taaatatgaa aaaaagctaa gaaatataaa tattaacgtt      1020
     gaggcgtgga agaatcgttt gtttccaatc aacgaatata atatgcgaaa agagatcaaa      1080
     gaagctatga aaaaagttct aagcagagaa ttccgcctat atgatttgcg ttcatttttt      1140
     gcatcatata tgattaagca aggtgtatca cctatgattg tgaatttgtt acaaggtaga      1200
     gctccaccac agcaattcca gatattacaa aaccactact tcgtggtctc agacatagag      1260
     ttacaacaat attatgataa atatgcaccg cgattgcttt ag                         1302
//

If you have problems or comments...

PBIL Back to PBIL home page