(data stored in ACNUC7421 zone)

EMBL: CP001402.PE731

CP001402.PE731       Location/Qualifiers
FT   CDS_pept        698632..698898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0749"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0749"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41367"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFF1"
FT                   /protein_id="ACR41367.1"
FT                   /translation="MELKRVYEDEDIIATYSPSYYEIKLLIMSLMREYKKKYNYYFTTV
FT                   SLHKELEKRGLQISPGMIRKILHELKKQGLVKEKINHKYIPHF"
     atggaattga aacgcgtata tgaagatgaa gacataatag ctacatactc tccatcctat        60
     tatgaaatca aattattgat aatgtctctt atgagagaat ataaaaagaa atataattat       120
     tattttacaa ctgtttctct tcataaagaa ctcgaaaaac gtggactaca aataagtcca       180
     ggcatgatta gaaaaattct acacgaattg aaaaaacaag gactagtaaa agaaaaaatc       240
     aatcataaat atattccgca tttctaa                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page