(data stored in ACNUC7421 zone)

EMBL: CP001402.PE733

CP001402.PE733       Location/Qualifiers
FT   CDS_pept        complement(699545..700282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0751"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0751"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41369"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFF3"
FT                   /protein_id="ACR41369.1"
FT                   /translation="MMSTKVEEKEEKKYIYKSTAKKIYKITDNQINEAIERGILTDYKY
FT                   RRNPHYRSAPESLLLNPKEIEEKLELIKQLPKYSEEEKQRKVEYQRKWRKANELVFYCP
FT                   LCNKNIRPPRDSEIRELYIKDLKDKDNSITGLIIAHLRHQHTDYDQKRLEAGKVVPDTE
FT                   EECKEIVTEDGDIDEECYEVPLDPFEYQFEKARYIGSLKKSYNRKVIDIAIKNGMLVST
FT                   EENERKILKPNYEVVSPKPKQGK"
     atgatgtcta caaaagtaga agaaaaagaa gaaaagaaat atatctataa gtcaacggca        60
     aagaagatct ataaaataac tgataaccag atcaatgaag caattgaaag aggtatattg       120
     acggattata aatatagaag aaatccgcat tatagatctg ctcccgaatc gttactatta       180
     aatcctaaag aaatcgaaga aaaattagag ttaatcaaac aattacctaa gtattctgaa       240
     gaagaaaaac aaagaaaagt agaatatcaa agaaaatgga gaaaagcaaa tgagttagta       300
     ttttactgcc cgttgtgcaa caagaatatt agacctccta gggattcaga aataagagaa       360
     ctatacatta aagatttgaa agataaggat aactctatta ctggtttaat aatagctcat       420
     ttaagacatc agcatacgga ttacgaccaa aaacgattgg aggcaggtaa agtagttcct       480
     gataccgaag aggagtgtaa agaaatagtt actgaggacg gtgatattga tgaggaatgt       540
     tatgaagtac cattagaccc tttcgaatat caatttgaaa aagccaggta tataggatcc       600
     cttaaaaaat catataacag gaaagtgatt gatatagcaa tcaaaaatgg aatgttggta       660
     agtactgagg aaaacgaaag aaaaatattg aaaccaaatt atgaagtagt ttctcctaaa       720
     ccaaaacaag gtaagtaa                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page