(data stored in ACNUC7421 zone)

EMBL: CP001402.PE734

CP001402.PE734       Location/Qualifiers
FT   CDS_pept        complement(701067..703058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0752"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0752"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41370"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFF4"
FT                   /protein_id="ACR41370.1"
FT                   /translation="MSETQTVTNNCFNFNNINICTNATGVIFRYNNNEIHADLDELKVT
FT                   RSLRAILEDLGFSREEAGKLVLSLQNTKEFSELINKINSPNIISFCLDMSKYDICTKEL
FT                   VNDPKDGIIKLVKYSLVTDEQTKQVTRAFNNFVPYAECYIDHIAKVKLIGLNESNIYKV
FT                   IFVKKDGNIINVIGDNDIIERSLKECGAKRDHSSDIIKMLIENAKIEEQLYYSSGPWVV
FT                   NNKVVFAKTSGYITQWKEDVKFSILENYDAKDVKRGIELIEKLINNYGNPAKAIAIISY
FT                   GVIAWAKHWFVDKAQYFPNLIIYGKENLGKTLLLDLLKVMYNAPDDLTPLREYQLRRVS
FT                   TLTTIPAILTEGNPFVEAMKKDEKLLQALTLISTSNIFTRAGSYEYGGLYLPIRAFLIP
FT                   TNEPVDDIVPYVKDKIIIIRFMPNEGFKDNPSVITPKRMTEDDKKAVRAVMAEVFKEFE
FT                   RRILDIEKAVKSLSREKLYEYYIELGYDILHTISSRFLITLPKPYIQTYNADNKDVEEI
FT                   IREAFYMFIEKEKNERTKQVDADDPPIIDPENPQETLDKCHFFISTKYNTVVFNSAFLR
FT                   RFGEHLVKEYGMQRYGNDRLAEILNVRRTRITRYGQTLNNVYEIEYNKSKEEYCKSLDG
FT                   KDIDEKEKEYCAQYGFYDSESHIFKVYK"
     atgagtgaga cgcaaacagt tactaataac tgctttaatt ttaacaatat taatatatgc        60
     acaaatgcaa ctggcgttat atttagatat aacaataatg aaatacacgc agatctagat       120
     gaattgaaag taacgcgatc cctaagagca atactagaag acctgggatt ttccagagaa       180
     gaggcgggta agctagtcct aagtctacaa aatactaaag agttttctga acttataaac       240
     aagattaact caccaaatat tatttcattt tgtttggata tgagtaagta tgacatttgt       300
     actaaagagc tagttaatga tcctaaggac ggaataataa agctagttaa gtatagttta       360
     gttactgatg agcaaactaa gcaggttacg cgggctttta acaattttgt gccatatgct       420
     gaatgctata tagatcatat agcaaaagtt aaacttatcg ggctgaacga gtctaatatc       480
     tataaagtta tattcgttaa gaaagacgga aatataatta atgttatagg agataatgat       540
     ataattgaac gatctttaaa agagtgtggt gcaaaaagag atcattcatc agacataata       600
     aagatgctta tagaaaacgc taagattgaa gaacagttat attattcatc aggtccatgg       660
     gtagttaata ataaagtagt ttttgctaaa acaagtggat atataaccca atggaaagaa       720
     gatgtaaagt tttcaatatt agaaaactat gacgctaaag acgtaaaaag agggatagaa       780
     ctgattgaga aattaattaa caattacggt aaccccgcga aagctatagc tataataagt       840
     tacggtgtaa tagcgtgggc taaacattgg tttgtagata aagctcagta cttccctaac       900
     ttgataattt atggtaagga gaatttaggc aaaacgttac tattagatct gctcaaagta       960
     atgtataacg cacccgatga tcttacaccg cttagagaat atcaattaag aagagtatct      1020
     acattgacca caataccagc cattttaacc gaaggtaatc catttgtaga agccatgaaa      1080
     aaagatgaaa aattactaca agctttaacg ctaataagta cttccaatat ttttactaga      1140
     gctgggtctt atgaatacgg cggtttatat ttacctataa gagcattttt aattccaact      1200
     aacgagcccg ttgatgatat agtaccttat gtaaaagata aaattattat aataagattt      1260
     atgccaaatg agggatttaa agataaccct agtgttataa cgccgaaaag gatgacagaa      1320
     gatgataaaa aagctgttag ggctgttatg gctgaggttt ttaaggagtt tgagaggaga      1380
     atactagata tagagaaagc ggttaaaagt ctatcgagag aaaaactata tgaatattat      1440
     atagagctag ggtatgatat actgcatacc atttcatcta gattcttgat aactttaccg      1500
     aaaccgtaca ttcaaactta taacgctgac aataaagacg ttgaggaaat aataagagaa      1560
     gcgttttaca tgtttattga aaaggagaag aacgaaagga caaagcaagt tgatgcagat      1620
     gatccgccta tcatagatcc tgaaaacccc caagaaactt tagataaatg ccatttcttc      1680
     atatctacta agtataatac agtagtgttc aactcagcgt tcctaaggag gtttggggaa      1740
     catctagtga aagagtacgg aatgcaaagg tatgggaatg atagattagc tgagatatta      1800
     aatgttagaa gaactagaat aactaggtat gggcaaactc taaataacgt ttatgagata      1860
     gagtataata aaagcaaaga agagtactgt aaaagtttgg atgggaaaga tattgacgaa      1920
     aaagaaaaag agtactgtgc ccaatacggt ttttatgatt ctgaaagtca tatttttaaa      1980
     gtatataaat ag                                                          1992
//

If you have problems or comments...

PBIL Back to PBIL home page