(data stored in ACNUC7421 zone)

EMBL: CP001402.PE735

CP001402.PE735       Location/Qualifiers
FT   CDS_pept        complement(703237..703401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0753"
FT                   /product="CopG DNA-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0753"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41371"
FT                   /db_xref="GOA:C4KFF5"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:C4KFF5"
FT                   /protein_id="ACR41371.1"
FT                   /translation="MFKMSSNKQLIGVRLRDEDRKLLKEIAKRYDISESDVIRIAIRKF
FT                   AKDMGIEVG"
     gtgttcaaaa tgtcatcaaa caaacagttg attggtgtga ggttaaggga tgaagataga        60
     aaattgttga aagaaatagc gaaaagatat gatattagcg aaagtgatgt aatacgaatt       120
     gcaattagaa agttcgcaaa agacatgggt atagaggtgg ggtga                       165
//

If you have problems or comments...

PBIL Back to PBIL home page